powered by:
Protein Alignment CG42359 and VMA21
DIOPT Version :9
Sequence 1: | NP_732404.2 |
Gene: | CG42359 / 42299 |
FlyBaseID: | FBgn0259705 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011619.3 |
Gene: | VMA21 / 852997 |
SGDID: | S000003337 |
Length: | 77 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 19/73 - (26%) |
Similarity: | 35/73 - (47%) |
Gaps: | 16/73 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 DTSAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLT---AVVVVNLVVAM 98
|....|...|:.::..|..||.|.|:.::. ||.| :::: |..:.|:|:.:
Yeast 4 DVPRAVINKLMLFTAAMVVLPVLTFFIIQQ-----------FTPN--TLISGGLAAAMANVVLIV 55
Fly 99 YVLKAFRE 106
|::.||||
Yeast 56 YIVVAFRE 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42359 | NP_732404.2 |
VMA21 |
41..>84 |
CDD:286525 |
10/42 (24%) |
VMA21 | NP_011619.3 |
VMA21 |
9..61 |
CDD:401413 |
14/64 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014426 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31792 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.100 |
|
Return to query results.
Submit another query.