DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42359 and VMA21

DIOPT Version :9

Sequence 1:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_011619.3 Gene:VMA21 / 852997 SGDID:S000003337 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:19/73 - (26%)
Similarity:35/73 - (47%) Gaps:16/73 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DTSAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLT---AVVVVNLVVAM 98
            |....|...|:.::..|..||.|.|:.::.           ||.|  ::::   |..:.|:|:.:
Yeast     4 DVPRAVINKLMLFTAAMVVLPVLTFFIIQQ-----------FTPN--TLISGGLAAAMANVVLIV 55

  Fly    99 YVLKAFRE 106
            |::.||||
Yeast    56 YIVVAFRE 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 10/42 (24%)
VMA21NP_011619.3 VMA21 9..61 CDD:401413 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014426
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.