DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42359 and Vma21

DIOPT Version :9

Sequence 1:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_006528324.1 Gene:Vma21 / 67048 MGIID:1914298 Length:161 Species:Mus musculus


Alignment Length:71 Identity:18/71 - (25%)
Similarity:39/71 - (54%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDTSAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYV 100
            |::.|.....||.::.||.|:|...::..::::.|....:.......::.:.|||.|::|:|::|
Mouse    80 ENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFV 144

  Fly   101 LKAFRE 106
            ..|:.|
Mouse   145 YVAWNE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 7/42 (17%)
Vma21XP_006528324.1 VMA21 86..148 CDD:370497 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.