powered by:
Protein Alignment CG42359 and Vma21
DIOPT Version :9
Sequence 1: | NP_732404.2 |
Gene: | CG42359 / 42299 |
FlyBaseID: | FBgn0259705 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006528324.1 |
Gene: | Vma21 / 67048 |
MGIID: | 1914298 |
Length: | 161 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 39/71 - (54%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 EDTSAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYV 100
|::.|.....||.::.||.|:|...::..::::.|....:.......::.:.|||.|::|:|::|
Mouse 80 ENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFV 144
Fly 101 LKAFRE 106
..|:.|
Mouse 145 YVAWNE 150
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42359 | NP_732404.2 |
VMA21 |
41..>84 |
CDD:286525 |
7/42 (17%) |
Vma21 | XP_006528324.1 |
VMA21 |
86..148 |
CDD:370497 |
14/61 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31792 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.