DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42359 and CG13829

DIOPT Version :9

Sequence 1:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:34/69 - (49%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYVLKA 103
            |..:.|.|::|..|:...|...|:.::..:.:|:.|::...:   |.:..||.|:..|..|:.:|
  Fly   135 SVFIVLLLMSYCSLIIGFPIATFFALKFVVLKSYAHINADII---STICTVVAVHAAVGFYIYRA 196

  Fly   104 FREK 107
            ...|
  Fly   197 IYAK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 8/42 (19%)
CG13829NP_651129.1 VMA21 <62..109 CDD:286525
VMA21 138..197 CDD:286525 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.