powered by:
Protein Alignment CG42359 and CG13829
DIOPT Version :9
Sequence 1: | NP_732404.2 |
Gene: | CG42359 / 42299 |
FlyBaseID: | FBgn0259705 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651129.1 |
Gene: | CG13829 / 42740 |
FlyBaseID: | FBgn0039059 |
Length: | 211 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 34/69 - (49%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 SAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYVLKA 103
|..:.|.|::|..|:...|...|:.::..:.:|:.|::...: |.:..||.|:..|..|:.:|
Fly 135 SVFIVLLLMSYCSLIIGFPIATFFALKFVVLKSYAHINADII---STICTVVAVHAAVGFYIYRA 196
Fly 104 FREK 107
...|
Fly 197 IYAK 200
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42359 | NP_732404.2 |
VMA21 |
41..>84 |
CDD:286525 |
8/42 (19%) |
CG13829 | NP_651129.1 |
VMA21 |
<62..109 |
CDD:286525 |
|
VMA21 |
138..197 |
CDD:286525 |
14/61 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR31792 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.