DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42359 and CG5969

DIOPT Version :10

Sequence 1:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_788549.1 Gene:CG5969 / 40269 FlyBaseID:FBgn0036998 Length:105 Species:Drosophila melanogaster


Alignment Length:108 Identity:27/108 - (25%)
Similarity:52/108 - (48%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNRKQQHVDVVPATTDDSPAVIDSPVEHHTQQEDTSAEVFLWLLAYSVLMFTLPFLGFYGVR 65
            |..||:|        |...:..|...:..:.|..|:.:|   |..:|.|.:|:..||.|.|:.::
  Fly     1 MSTKNKK--------AAGGNGVAPKQTRQQSHDSQDYSS---FKTVLFYCMLIVFLPVLTFFVLK 54

  Fly    66 SWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYVLKAFREKP 108
            .::.:.|..:....||..|.:.|||.:::.:.:|:.:|:...|
  Fly    55 GFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:462801 11/42 (26%)
CG5969NP_788549.1 VMA21 30..93 CDD:462801 17/65 (26%)

Return to query results.
Submit another query.