DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42359 and R07E5.7

DIOPT Version :9

Sequence 1:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_497898.1 Gene:R07E5.7 / 175577 WormBaseID:WBGene00011115 Length:191 Species:Caenorhabditis elegans


Alignment Length:111 Identity:30/111 - (27%)
Similarity:54/111 - (48%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IDSPVEHHTQQ----EDTSAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSV 85
            :.:|:....:|    |.::..:.| |:|:|.:|||||.|....:..|:.....||.......::.
 Worm    92 LKAPIRPDQEQFYTAEHSNRAITL-LIAFSAMMFTLPLLVMASLYYWVFIDHFHLPPAEAMLYAG 155

  Fly    86 LTAVVVVNLVVAMYVLKAFREKPPPPLEPVQQDEDDEPEAAEPKKE 131
            :.|.:||.|:.|.:...|::|         ::|.:|:.. ||.|||
 Worm   156 VCAALVVILIAAAFCYIAWKE---------EKDAEDKLR-AEKKKE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42359NP_732404.2 VMA21 41..>84 CDD:286525 13/42 (31%)
R07E5.7NP_497898.1 VMA21 111..174 CDD:286525 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.