DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11779 and timm44

DIOPT Version :9

Sequence 1:NP_650786.2 Gene:CG11779 / 42298 FlyBaseID:FBgn0038683 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_012811621.2 Gene:timm44 / 100145471 XenbaseID:XB-GENE-946996 Length:451 Species:Xenopus tropicalis


Alignment Length:431 Identity:219/431 - (50%)
Similarity:321/431 - (74%) Gaps:14/431 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ALVRDRA--CLFTCQQASQNLQQQQPRFYSAPGRRAGFFSQFFDNMKAEMDKNKEIKDNIRKFRE 99
            :||:||:  |:     ....|..||.|:||:.||| ||.....||:|.|:.||||:|:||:||||
 Frog    27 SLVKDRSVYCV-----GCPTLVCQQMRYYSSSGRR-GFLGGLLDNIKQELSKNKEMKENIKKFRE 85

  Fly   100 EAQKLEESDALKSARQKFNIVESEAQKSSSMLKEQLGAIKERVGDVLEDASKSHLAKKV---TEE 161
            ||:||||||||:.||:||..:|.|..|:|.:.|::...:.:.|.:.|::..|:.|.:|.   .||
 Frog    86 EAKKLEESDALQQARRKFKTIELETMKTSEVFKKKFEQMSDTVKESLDEVGKTDLGRKFRESVEE 150

  Fly   162 LSKKARGVSDTISDTSGKLGQTSAFQAISNTTTTIKKEMDSASI-ENRVYRAPAKLRKRVQLV-- 223
            .:|.|:..:::::....|:|:|:||:|||....|:|||.|.:.: :...||.|::||||.:..  
 Frog   151 AAKTAKQSAESVTKGGEKIGKTAAFKAISQGVETVKKEFDESVLGQTGPYRPPSRLRKRSEFSGD 215

  Fly   224 MSDSDRVVEPNTEATGMELHKDSKFYESWENFKNNNTYVNKVLDWKVKYDESENPVIRASRLLTD 288
            .:..:::.|.|.||.||.||||||:|:.|::||:||...|:..:.|:|||||:|..:||||.:||
 Frog   216 RTKEEKIFEANEEAMGMVLHKDSKWYQQWKDFKDNNMVFNRFFEMKMKYDESDNAFVRASRTITD 280

  Fly   289 KVSDVMGGLFSKTELSETMTELVKIDPSFDQKDFLRDCETDIIPNILESIVRGDLEILKDWCFES 353
            ||||::||||||||:||.:||::|:||:||:..||:.||.||||||||:::||||::|||||:|:
 Frog   281 KVSDLIGGLFSKTEMSEVLTEILKVDPNFDKDKFLKLCERDIIPNILEAMIRGDLDVLKDWCYEA 345

  Fly   354 TFNIIANPIKEAKKAGVYLDSKILDIENIELAMGKVMEQGPVLIITFQAQQIMCVRDQKSQVVEG 418
            |::.:|:||::||..|:..:||||||:||:|||||:||||||||||||||.:|.:.:||..||||
 Frog   346 TYSQLAHPIQQAKAMGLQFNSKILDIDNIDLAMGKMMEQGPVLIITFQAQLVMVITNQKGDVVEG 410

  Fly   419 DPEKVMRVHYVWVLCRDRNELNPKAAWRLMELSANSSEQFV 459
            |.:||:|:.|||.||||::||||.|||||:::|:::|||.:
 Frog   411 DRDKVLRMLYVWALCRDQDELNPYAAWRLLDISSSASEQIL 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11779NP_650786.2 3a0801s03tim44 78..449 CDD:130057 199/376 (53%)
Tim44 304..452 CDD:282178 92/147 (63%)
timm44XP_012811621.2 3a0801s03tim44 64..441 CDD:130057 199/376 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 231 1.000 Domainoid score I2393
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4631
Inparanoid 1 1.050 389 1.000 Inparanoid score I1963
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1041560at2759
OrthoFinder 1 1.000 - - FOG0003783
OrthoInspector 1 1.000 - - oto104017
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3720
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.