powered by:
Protein Alignment nos and Edaradd
DIOPT Version :9
Sequence 1: | NP_476658.1 |
Gene: | nos / 42297 |
FlyBaseID: | FBgn0002962 |
Length: | 401 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_574055.4 |
Gene: | Edaradd / 498769 |
RGDID: | 1564010 |
Length: | 205 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 23/68 - (33%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 KAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPI-CGASGDSAHTIKYCPKKP 374
||||.......|..|::.:.....:...|:....|....|...|.. |..|..| |:.|
Rat 43 KAKECDAVTSNCPPNSDDQHQGEENDFPDSTGDPLSGVSRNQPCKEGCPCSSCS-------PRAP 100
Fly 375 IIT 377
.|:
Rat 101 TIS 103
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
nos | NP_476658.1 |
zf-nanos |
319..371 |
CDD:283413 |
9/52 (17%) |
Edaradd | XP_574055.4 |
Death |
122..189 |
CDD:278932 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4602 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.