DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and nanos1

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_988857.1 Gene:nanos1 / 394451 XenbaseID:XB-GENE-868377 Length:128 Species:Xenopus tropicalis


Alignment Length:64 Identity:34/64 - (53%)
Similarity:44/64 - (68%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 SKAKEISRH--CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            |||.|...|  |.||.:|.|.:::.:||.:|....|||||.||.|.||:|||:||.|||::|||
 Frog    50 SKAAEAHGHKGCGFCRSNREAQSLYSSHRLRAPDGRVLCPVLRGYTCPLCGANGDWAHTMRYCP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 27/51 (53%)
nanos1NP_988857.1 Essential for its translational repressor activity. /evidence=ECO:0000250 7..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..58 4/7 (57%)
zf-nanos 61..113 CDD:283413 27/51 (53%)
C2HC 1 61..88 10/26 (38%)
C2HC 2 96..112 10/15 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9048
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm47918
Panther 1 1.100 - - O PTHR12887
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.