powered by:
Protein Alignment nos and nanos1
DIOPT Version :9
Sequence 1: | NP_476658.1 |
Gene: | nos / 42297 |
FlyBaseID: | FBgn0002962 |
Length: | 401 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_988857.1 |
Gene: | nanos1 / 394451 |
XenbaseID: | XB-GENE-868377 |
Length: | 128 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 34/64 - (53%) |
Similarity: | 44/64 - (68%) |
Gaps: | 2/64 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 SKAKEISRH--CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
|||.|...| |.||.:|.|.:::.:||.:|....|||||.||.|.||:|||:||.|||::|||
Frog 50 SKAAEAHGHKGCGFCRSNREAQSLYSSHRLRAPDGRVLCPVLRGYTCPLCGANGDWAHTMRYCP 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
73 |
1.000 |
Domainoid score |
I9048 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001526 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47918 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12887 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4677 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.040 |
|
Return to query results.
Submit another query.