DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and Nanos2

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_918953.2 Gene:Nanos2 / 378430 MGIID:2676627 Length:136 Species:Mus musculus


Alignment Length:89 Identity:35/89 - (39%)
Similarity:47/89 - (52%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 SNNNNNNNKVYKRYNSKAKEISRH------------CVFCENNNEPEAVINSHSVRDNFNRVLCP 347
            |.......:|.:..||:.:|.|..            |.||::|.|...|..||.::.....|:||
Mouse    25 SRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTICNFCKHNGESRHVYTSHQLKTPEGVVVCP 89

  Fly   348 KLRTYVCPICGASGDSAHTIKYCP 371
            .||.||||:|||:||.|||:||||
Mouse    90 ILRHYVCPLCGATGDQAHTLKYCP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 27/51 (53%)
Nanos2NP_918953.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..51 5/23 (22%)
zf-nanos 61..113 CDD:283413 27/51 (53%)
C2HC 1 61..88 9/26 (35%)
C2HC 2 96..112 11/15 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849939
Domainoid 1 1.000 80 1.000 Domainoid score I8579
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm42807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12887
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.