Sequence 1: | NP_476658.1 | Gene: | nos / 42297 | FlyBaseID: | FBgn0002962 | Length: | 401 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092092.1 | Gene: | NANOS3 / 342977 | HGNCID: | 22048 | Length: | 192 | Species: | Homo sapiens |
Alignment Length: | 69 | Identity: | 32/69 - (46%) |
---|---|---|---|
Similarity: | 42/69 - (60%) | Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 KVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTI 367
Fly 368 KYCP 371 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nos | NP_476658.1 | zf-nanos | 319..371 | CDD:283413 | 26/51 (51%) |
NANOS3 | NP_001092092.1 | Trypan_PARP | <24..>74 | CDD:330686 | 3/12 (25%) |
zf-nanos | 77..129 | CDD:310389 | 26/51 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165159565 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4602 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001526 | |
OrthoInspector | 1 | 1.000 | - | - | otm40734 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12887 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.800 |