DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and NANOS1

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_955631.1 Gene:NANOS1 / 340719 HGNCID:23044 Length:292 Species:Homo sapiens


Alignment Length:53 Identity:33/53 - (62%)
Similarity:39/53 - (73%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            ||||.||.|..|:..:|.::....|||||.||.|.||:||||||:||||||||
Human   214 CVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 31/51 (61%)
NANOS1NP_955631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Essential for its translational repressor activity. /evidence=ECO:0000250 40..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..121
zf-nanos 214..266 CDD:283413 31/51 (61%)
C2HC 1 214..241 11/26 (42%)
C2HC 2 249..265 13/15 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159567
Domainoid 1 1.000 80 1.000 Domainoid score I8622
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm40734
orthoMCL 1 0.900 - - OOG6_108330
Panther 1 1.100 - - O PTHR12887
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.650

Return to query results.
Submit another query.