Sequence 1: | NP_476658.1 | Gene: | nos / 42297 | FlyBaseID: | FBgn0002962 | Length: | 401 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955631.1 | Gene: | NANOS1 / 340719 | HGNCID: | 23044 | Length: | 292 | Species: | Homo sapiens |
Alignment Length: | 53 | Identity: | 33/53 - (62%) |
---|---|---|---|
Similarity: | 39/53 - (73%) | Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nos | NP_476658.1 | zf-nanos | 319..371 | CDD:283413 | 31/51 (61%) |
NANOS1 | NP_955631.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..41 | ||
Essential for its translational repressor activity. /evidence=ECO:0000250 | 40..56 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..121 | ||||
zf-nanos | 214..266 | CDD:283413 | 31/51 (61%) | ||
C2HC 1 | 214..241 | 11/26 (42%) | |||
C2HC 2 | 249..265 | 13/15 (87%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..292 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165159567 | |
Domainoid | 1 | 1.000 | 80 | 1.000 | Domainoid score | I8622 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4602 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6952 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001526 | |
OrthoInspector | 1 | 1.000 | - | - | otm40734 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108330 | |
Panther | 1 | 1.100 | - | - | O | PTHR12887 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.650 |