DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and NANOS1

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_955631.1 Gene:NANOS1 / 340719 HGNCID:23044 Length:292 Species:Homo sapiens


Alignment Length:53 Identity:33/53 - (62%)
Similarity:39/53 - (73%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            ||||.||.|..|:..:|.::....|||||.||.|.||:||||||:||||||||
Human   214 CVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 33/53 (62%)
NANOS1NP_955631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Essential for its translational repressor activity. /evidence=ECO:0000250 40..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..121
zf-nanos 214..267 CDD:461728 33/53 (62%)
C2HC 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 214..241 11/26 (42%)
C2HC 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 249..265 13/15 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..292
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.