DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and Nanos1

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_848508.2 Gene:Nanos1 / 332397 MGIID:2669254 Length:267 Species:Mus musculus


Alignment Length:79 Identity:36/79 - (45%)
Similarity:48/79 - (60%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP---------KKP 374
            ||||.||.|..|:..:|.::....|||||.||.|.||:||||||:||||||||         :.|
Mouse   189 CVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPTVRPP 253

  Fly   375 IITMEDAIKAESFR 388
            ..:..|::.::..|
Mouse   254 PRSNRDSLPSKKLR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 33/61 (54%)
Nanos1NP_848508.2 Essential for its translational repressor activity. /evidence=ECO:0000250 40..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..94
zf-nanos 189..242 CDD:461728 32/52 (62%)
C2HC 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 189..216 11/26 (42%)
C2HC 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 224..240 13/15 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..267 2/23 (9%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.