DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and Nanos1

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_848508.2 Gene:Nanos1 / 332397 MGIID:2669254 Length:267 Species:Mus musculus


Alignment Length:79 Identity:36/79 - (45%)
Similarity:48/79 - (60%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP---------KKP 374
            ||||.||.|..|:..:|.::....|||||.||.|.||:||||||:||||||||         :.|
Mouse   189 CVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPTVRPP 253

  Fly   375 IITMEDAIKAESFR 388
            ..:..|::.::..|
Mouse   254 PRSNRDSLPSKKLR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 31/51 (61%)
Nanos1NP_848508.2 Essential for its translational repressor activity. /evidence=ECO:0000250 40..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..94
zf-nanos 189..241 CDD:283413 31/51 (61%)
C2HC 1 189..216 11/26 (42%)
C2HC 2 224..240 13/15 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..267 2/23 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849937
Domainoid 1 1.000 80 1.000 Domainoid score I8579
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm42807
orthoMCL 1 0.900 - - OOG6_108330
Panther 1 1.100 - - O PTHR12887
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.