DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and nanos1

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001292590.1 Gene:nanos1 / 322903 ZFINID:ZDB-GENE-030131-1623 Length:228 Species:Danio rerio


Alignment Length:100 Identity:39/100 - (39%)
Similarity:54/100 - (54%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 LGVGMGL-GLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHS 336
            :|:|.|. |..:.|.:.:....::.|               |:..:.||||.||..||.|..||.
Zfish   119 IGIGGGFAGFDLFGVERKMRKPAARN---------------KQEPKICVFCRNNGAPEEVYGSHV 168

  Fly   337 VRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            ::....||:||.||.|.||:|.|:||:||||||||
Zfish   169 LKTPDGRVVCPILRAYTCPLCSANGDNAHTIKYCP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 31/52 (60%)
nanos1NP_001292590.1 Essential for its translational repressor activity. /evidence=ECO:0000250 19..34
zf-nanos 151..204 CDD:461728 31/52 (60%)
C2HC 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 151..178 13/26 (50%)
C2HC 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00855 186..202 11/15 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.