DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and Nanos3

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001099415.1 Gene:Nanos3 / 288909 RGDID:1306672 Length:178 Species:Rattus norvegicus


Alignment Length:63 Identity:32/63 - (50%)
Similarity:42/63 - (66%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 NSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            :|.|.|  |.|.||::|.|..|:..||.::|...|||||.||.||||.|||:.:.|||.::||
  Rat    49 SSAAPE--RLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 26/51 (51%)
Nanos3NP_001099415.1 zf-nanos 57..109 CDD:399039 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm44873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12887
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.