powered by:
Protein Alignment nos and Nanos3
DIOPT Version :9
Sequence 1: | NP_476658.1 |
Gene: | nos / 42297 |
FlyBaseID: | FBgn0002962 |
Length: | 401 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099415.1 |
Gene: | Nanos3 / 288909 |
RGDID: | 1306672 |
Length: | 178 |
Species: | Rattus norvegicus |
Alignment Length: | 63 |
Identity: | 32/63 - (50%) |
Similarity: | 42/63 - (66%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 309 NSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
:|.|.| |.|.||::|.|..|:..||.::|...|||||.||.||||.|||:.:.|||.::||
Rat 49 SSAAPE--RLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCP 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166353618 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4602 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001526 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm44873 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12887 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.800 |
|
Return to query results.
Submit another query.