DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and nos-1

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_496358.1 Gene:nos-1 / 191735 WormBaseID:WBGene00003783 Length:311 Species:Caenorhabditis elegans


Alignment Length:154 Identity:45/154 - (29%)
Similarity:63/154 - (40%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNN 299
            |..|.|. ||:      :|  |:||..              |...|......|:...:||:.|.|
 Worm   175 LQEYLEQ-NNL------LP--PSTMPF--------------GENSGFHGYNPQMNVHNNSTRNGN 216

  Fly   300 NNNKVYKRYNSKAKEISR--H---CVFCENNNEPEAVINS--------------HSVRDNFNRVL 345
            ..|: .:|.||.:.....  |   |.||.......|.:::              |..:.. .||:
 Worm   217 VENR-EQRNNSTSPPRGNPPHPLCCCFCFGTASEFARLHTLPAPRKDDRGPWSDHCSKKR-GRVV 279

  Fly   346 CPKLRTYVCPICGASGDSAHTIKY 369
            |||||:.||.||||:||:|||.|:
 Worm   280 CPKLRSMVCGICGATGDNAHTTKH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 24/65 (37%)
nos-1NP_496358.1 zf-nanos 240..304 CDD:368589 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108330
Panther 1 1.100 - - LDO PTHR12887
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.650

Return to query results.
Submit another query.