DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and nos-2

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_495452.1 Gene:nos-2 / 174158 WormBaseID:WBGene00003784 Length:259 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:63/161 - (39%) Gaps:50/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PVQGEQLRGASNSSNNNN--------NNNKVYKRYN---------------SKAKEISRHCVFCE 323
            |...|.||..:..|.||:        ::..:|.::|               ..|:|::|:.  .|
 Worm    87 PPPAEYLRLPTFLSTNNSGFFDSVVASDFNLYGKFNDWLNDSKPRSGSFAIESAEELARNP--RE 149

  Fly   324 NNNEPEAVINSHSVR----------------DNFNRVLCPKLRTYV-CPICGASGDSAHTIKYCP 371
            ..:|||  :.|...|                :...|..|.||.:.. |.||||.|:..||..|||
 Worm   150 TRSEPE--VPSLFKRREYGCGYCRSVGYMRWETHTRKKCDKLSSLAPCKICGARGEMNHTETYCP 212

  Fly   372 KKP---IITMEDAIK-AESFRLAKSSY--YK 396
            .||   :...||..: .|:.|..:|.|  ||
 Worm   213 MKPSSQLFFNEDFSRDFENRRFQRSRYQFYK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 20/69 (29%)
nos-2NP_495452.1 zf-nanos 167..213 CDD:461728 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.