DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and nos-2

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_495452.1 Gene:nos-2 / 174158 WormBaseID:WBGene00003784 Length:259 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:63/161 - (39%) Gaps:50/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PVQGEQLRGASNSSNNNN--------NNNKVYKRYN---------------SKAKEISRHCVFCE 323
            |...|.||..:..|.||:        ::..:|.::|               ..|:|::|:.  .|
 Worm    87 PPPAEYLRLPTFLSTNNSGFFDSVVASDFNLYGKFNDWLNDSKPRSGSFAIESAEELARNP--RE 149

  Fly   324 NNNEPEAVINSHSVR----------------DNFNRVLCPKLRTYV-CPICGASGDSAHTIKYCP 371
            ..:|||  :.|...|                :...|..|.||.:.. |.||||.|:..||..|||
 Worm   150 TRSEPE--VPSLFKRREYGCGYCRSVGYMRWETHTRKKCDKLSSLAPCKICGARGEMNHTETYCP 212

  Fly   372 KKP---IITMEDAIK-AESFRLAKSSY--YK 396
            .||   :...||..: .|:.|..:|.|  ||
 Worm   213 MKPSSQLFFNEDFSRDFENRRFQRSRYQFYK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 19/68 (28%)
nos-2NP_495452.1 zf-nanos 167..212 CDD:368589 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108330
Panther 1 1.100 - - O PTHR12887
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.