DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and nanos3

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_571953.1 Gene:nanos3 / 140631 ZFINID:ZDB-GENE-011221-1 Length:159 Species:Danio rerio


Alignment Length:159 Identity:46/159 - (28%)
Similarity:72/159 - (45%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 NLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQ-----------AQTAATVSTNLGVGM 277
            :|:...|:.|.....|......|::  |:..|....|::           .|.||.:.:..|   
Zfish     4 SLLQFILSAHGSMETRNQDFQPWKD--YMGLADMIRGMKRQEMQSDADSDEQAAALLESPSG--- 63

  Fly   278 GLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFN 342
                |::       |..|...|.:....|..:|.|:.  :.|.||::|.|.|||..||.:::...
Zfish    64 ----PIR-------SRDSPEQNTSPGGGKPKSSPAER--KFCSFCKHNGETEAVYTSHYLKNRDG 115

  Fly   343 RVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            .|:||.||.|.||:|||:|..|||.::||
Zfish   116 DVMCPYLRQYKCPLCGATGAKAHTKRFCP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 25/51 (49%)
nanos3NP_571953.1 zf-nanos 92..144 CDD:283413 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595759
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm25058
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12887
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.