DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and EDARADD

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_665860.2 Gene:EDARADD / 128178 HGNCID:14341 Length:215 Species:Homo sapiens


Alignment Length:90 Identity:19/90 - (21%)
Similarity:29/90 - (32%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVI 332
            |..:.|...|....|:|..:|..|........|..:     ||..|.......|.::..:|...|
Human    31 TDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPR-----NSDMKNQGEENGFPDSTGDPLPEI 90

  Fly   333 NSHSVRDNFNRVLCPKLRTYVCPIC 357
            :    :||..:..|      .|..|
Human    91 S----KDNSCKENC------TCSSC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 8/39 (21%)
EDARADDNP_665860.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..86 5/28 (18%)
Death 132..199 CDD:278932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.