DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nanos and nanos

DIOPT Version :10

Sequence 1:NP_476658.1 Gene:nanos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_316157.2 Gene:nanos / 1276771 VectorBaseID:AGAMI1_007939 Length:259 Species:Anopheles gambiae


Alignment Length:131 Identity:47/131 - (35%)
Similarity:60/131 - (45%) Gaps:11/131 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 APNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHC 319
            ||...|.:...|..|:..|          :...|:..||.....:....:.|..|....|:. ||
Mosquito   103 APEMDGSELMEAVDVAAEL----------KNMVLQDISNQPKQQSTTRPLRKCRNKSTCELD-HC 156

  Fly   320 VFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKA 384
            |||.||.....|..||..:|....|.||.|:|:||..|.|:|..|||.||||.||:||.||.:..
Mosquito   157 VFCFNNKADREVYESHRCKDEAGNVTCPVLQTFVCMRCKATGTKAHTAKYCPLKPVITPEDCLAM 221

  Fly   385 E 385
            |
Mosquito   222 E 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nanosNP_476658.1 NBR_nanos 135..182 CDD:467849
zf-nanos 319..372 CDD:461728 26/52 (50%)
nanosXP_316157.2 zf-nanos 156..209 CDD:461728 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.