DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nos and LOC101733112

DIOPT Version :9

Sequence 1:NP_476658.1 Gene:nos / 42297 FlyBaseID:FBgn0002962 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_031751157.1 Gene:LOC101733112 / 101733112 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:234 Identity:62/234 - (26%)
Similarity:96/234 - (41%) Gaps:71/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GSAPPQVQMPPQQQHQQQQGLHLPLGRNPAQLQT--------NG-GNLMPIPLATHWLNNYREHL 242
            |:|.||..:|       ::.:::|:...|....|        || ||..|..||.          
 Frog    47 GNATPQPLLP-------RKLIYVPMLYCPTAGDTSLLNHKMDNGMGNYTPKQLAP---------- 94

  Fly   243 NNVWRNMSYIPAA------PNTMGLQAQTAATVSTNLGVGM-----------------GLGLPVQ 284
                ||...|||.      .||:.:| |.||.:...|.:..                 |:.||||
 Frog    95 ----RNPFLIPATNIPVEMDNTLQIQ-QLAAEMGQYLPIPQLAGSLNNHPARESQAEKGISLPVQ 154

  Fly   285 ------GEQLRGASNS-----------SNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVI 332
                  |..:..:::|           ||..:|.:........:.....:.|.||::|.|...|.
 Frog   155 ERANETGTSIPPSASSHFSNASPHGEDSNGGDNPDLQCGVCPEEQNATGKFCKFCKHNGESSRVY 219

  Fly   333 NSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371
            ::|::|::...::||.||.|.||:|||:|..:||.||||
 Frog   220 STHTLRNSNGIIICPVLRKYTCPLCGATGALSHTRKYCP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nosNP_476658.1 zf-nanos 319..371 CDD:283413 23/51 (45%)
LOC101733112XP_031751157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9048
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001526
OrthoInspector 1 1.000 - - otm47918
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.