DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and SIS2

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_012998.1 Gene:SIS2 / 853946 SGDID:S000001780 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:30/149 - (20%)
Similarity:55/149 - (36%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 ISLQLVPKMLAPLASLWVPHAFVVSFKLETDESLLIVKARDSLNKYKHKLVIANVLQTRKHRVVF 268
            |:|.|...:|..:...|.|             |..|:.|...::...:.::....|||.|..:.:
Yeast   401 IALGLCDNLLTSVIRAWNP-------------SYPILLAPSMVSSTFNSMMTKKQLQTIKEEMSW 452

  Fly   269 VT---PTDSYELHLTREQTLQGLEIEEPIVADVVQKHGEFISNAQQRQXPLSMRRRPQTQHQQHH 330
            ||   |::.. :.:..:..|.|:.....||..:|.|.|.:..|.::.. ..........:.....
Yeast   453 VTVFKPSEKV-MDINGDIGLGGMMDWNEIVNKIVMKLGGYPKNNEEEDDDEDEEEDDDEEEDTED 516

  Fly   331 HQQLATGDEDEDGGDLDRD 349
            ..:....|:|:|..|.|.|
Yeast   517 KNENNNDDDDDDDDDDDDD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 9/52 (17%)
SIS2NP_012998.1 CoaBC 167..495 CDD:223529 23/107 (21%)
Flavoprotein <353..474 CDD:418540 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0452
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.