DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and CAB3

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_012835.1 Gene:CAB3 / 853774 SGDID:S000001571 Length:571 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:51/216 - (23%)
Similarity:80/216 - (37%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DMLDIADNSQSSTIAIKPDSVDVFAPVLAKYKIARETQMILYVNFTSVVDYMWLLRAACECLAAF 168
            |..||..:|.||..:...|.||  :|.:.|..|.......:|.|..|........:||       
Yeast   217 DGTDIRKHSVSSGTSNSEDEVD--SPSMEKNSIVHMPGDFIYFNPKSNASKPITAKAA------- 272

  Fly   169 EERAVLYLAAAVSDFYIPEDMMPTHKMQSGDGAPTISLQLVPKMLAPLASLWVPHAFVVSFKLET 233
                  .|:|..|          |||.:....|||     .|:         ||  |...|:.|.
Yeast   273 ------PLSANNS----------THKNKEVITAPT-----GPR---------VP--FTEFFQKED 305

  Fly   234 DESL-LIVKARDSLNKYKHKLVIANVLQTRKHRVVFVTPTDSYELHLTR--EQTLQGLEI----- 290
            |:.. :::.|..|:...|..|:|..:.:      ::.....|.:|.:|:  |..|:||::     
Yeast   306 DKKFHILIGATGSVATIKVPLIIDKLFK------IYGPEKISIQLIVTKPAEHFLKGLKMSTHVK 364

  Fly   291 ----EEPIVADVVQKHGEFIS 307
                |:..|.|.|.|:...:|
Yeast   365 IWREEDAWVFDAVNKNDTSLS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 38/153 (25%)
CAB3NP_012835.1 CoaBC 23..514 CDD:223529 51/216 (24%)
Flavoprotein 264..497 CDD:418540 36/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0452
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.