DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and PPCS

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_078940.2 Gene:PPCS / 79717 HGNCID:25686 Length:311 Species:Homo sapiens


Alignment Length:304 Identity:123/304 - (40%)
Similarity:184/304 - (60%) Gaps:8/304 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPADFEDN------RSLLKEFCERHNKLQNRIVLVTSGGTTVPLEHNTVRFVDNFSAGTRGSASA 71
            |.|:|...      ..::..|..|......|:||||||||.||||...|||:||||:|.||:.||
Human     6 PVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSA 70

  Fly    72 EYFLDHDYAVIFMHRHKSLEPFTRHFTGQQFFDMLDIADNSQSSTIAIKPD--SVDVFAPVLAKY 134
            |.||...|.|:|::|.:|..|:...|..|.:...|..:..:.|..::::.:  ::..||..|..|
Human    71 EAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSY 135

  Fly   135 KIARETQMILYVNFTSVVDYMWLLRAACECLAAFEERAVLYLAAAVSDFYIPEDMMPTHKMQSGD 199
            :.|......|.|.||::.||:.||:||.:.|......|:.||||||||||:|...||.||:||..
Human   136 QEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIQSSG 200

  Fly   200 GAPTISLQLVPKMLAPLASLWVPHAFVVSFKLETDESLLIVKARDSLNKYKHKLVIANVLQTRKH 264
            |...|::::|||:|:||...|.|.||::|||||||.:::|.:||.:|..|:|::|:||:|::|:.
Human   201 GPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANILESRQS 265

  Fly   265 RVVFVTPTDSYELHLTREQTLQGLEIEEPIVADVVQKHGEFISN 308
            .|..||.....:|.|:.|:..:|:||||.||.::..:|..||.:
Human   266 FVFIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFIGD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 98/224 (44%)
PPCSNP_078940.2 DFP <15..302 CDD:332014 117/286 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149945
Domainoid 1 1.000 109 1.000 Domainoid score I6384
eggNOG 1 0.900 - - E1_COG0452
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6173
Inparanoid 1 1.050 225 1.000 Inparanoid score I3514
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53953
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004187
OrthoInspector 1 1.000 - - oto90859
orthoMCL 1 0.900 - - OOG6_102247
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1904
SonicParanoid 1 1.000 - - X2934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.