DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and Ppcdc

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001344841.1 Gene:Ppcdc / 66812 MGIID:1914062 Length:204 Species:Mus musculus


Alignment Length:208 Identity:45/208 - (21%)
Similarity:66/208 - (31%) Gaps:75/208 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 RAACECLAAFEER------------AVLYLAAAVS-------------------DFYIPEDMMPT 192
            :|.|......|||            |.|.|...||                   .||.|:|:..|
Mouse     4 KAPCPAAVPSEERKFRVLVGVTGSVAALKLPLLVSKLLDVPGLEVTVVTTERAKHFYSPQDVPVT 68

  Fly   193 -------HKMQSGDGAPTISLQLVPKMLAPLASLWVPHAFVVSFKLET--------DESLL--IV 240
                   .:|......|.:.:.|         ..|.....|......|        .::||  ::
Mouse    69 LYSDADEWEMWKRRSDPVLHIDL---------RRWADLMLVAPLDANTLGKVASGICDNLLTCVI 124

  Fly   241 KARDSLNK------------YKHKLVIANVLQTRKHRVVFVTPTDSYELHLTREQTLQGLEIEEP 293
            :|.| |||            ::|.|....|.|.:....|.: |..|.:| :..:|.|..:...|.
Mouse   125 RAWD-LNKPLLFCPAMNTAMWEHPLTAQQVAQLKAFGYVEI-PCVSKKL-VCGDQGLGAMAEVET 186

  Fly   294 IVAD---VVQKHG 303
            |||.   |:.:||
Mouse   187 IVAKVQAVLSQHG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 30/157 (19%)
PpcdcNP_001344841.1 Flavoprotein 8..195 CDD:418540 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0452
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.