DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and Ppcdc

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001286691.1 Gene:Ppcdc / 246533 FlyBaseID:FBgn0050290 Length:191 Species:Drosophila melanogaster


Alignment Length:159 Identity:34/159 - (21%)
Similarity:61/159 - (38%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 MILYVNFTSVVDYMWLLRAACECLAAFEERAVLYLAAAVSDFY----IPEDMMPTHKMQ-----S 197
            ||......:.:....|:|...:....|:....:.:..|...|:    |||::...|...     :
  Fly     8 MIAATGSVATIKLAQLIRELSDERLPFKFHLKVLITEAAKHFFELEQIPENVPIYHNRDEWITWN 72

  Fly   198 GDGAPTISLQLVP----KMLAPLASLWVPHAFVVSFKLET---DESLL-IVKARDSLNKYKHKLV 254
            ..|.|.:.:.|..    .::|||::..:.       |:.|   |..:: :|:|.| |.|   .|:
  Fly    73 KRGDPVLHIDLGKWADLLVIAPLSANSLS-------KMATGICDNIVMCVVRAWD-LEK---PLL 126

  Fly   255 IANVLQTRKHRVVFVTPTDSYELHLTREQ 283
            .|..:.||           .|:..:||||
  Fly   127 FAPAMNTR-----------MYDHPITREQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 26/131 (20%)
PpcdcNP_001286691.1 Flavoprotein 7..187 CDD:302781 34/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0452
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.