DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcs and F25H9.6

DIOPT Version :9

Sequence 1:NP_650784.3 Gene:Ppcs / 42295 FlyBaseID:FBgn0261285 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_506341.1 Gene:F25H9.6 / 179829 WormBaseID:WBGene00009138 Length:237 Species:Caenorhabditis elegans


Alignment Length:104 Identity:20/104 - (19%)
Similarity:43/104 - (41%) Gaps:34/104 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QLVPKMLAPLASLWVPHAFVVSFKLETDE------------SLLIVKARDSLNKYKHKLVIANVL 259
            :::|::..||..         :.|:..||            |:.::||.:.:::...|:....:|
 Worm    20 EIMPEIRPPLTR---------THKIVRDESGKHNLLLILTGSIAVMKAPELISELYEKIGRDRIL 75

  Fly   260 QTRKHRVVFVTPTDSYEL-HLTREQTLQGLEIEEPIVAD 297
                  :..||..::.:| |      :|.||.:|.:..|
 Worm    76 ------IKVVTTENAMKLCH------IQKLEFDEIVYED 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcsNP_650784.3 DFP 34..257 CDD:296430 10/61 (16%)
F25H9.6NP_506341.1 Flavoprotein 42..222 CDD:388525 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0452
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.