DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and ROT3

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_568002.1 Gene:ROT3 / 829790 AraportID:AT4G36380 Length:524 Species:Arabidopsis thaliana


Alignment Length:485 Identity:95/485 - (19%)
Similarity:173/485 - (35%) Gaps:128/485 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YGDIFFMPGIMGNPPFLSTHNPQDFEVVFRNEG--VWPNRPGNYTLLYHREEYRKDFYQGVMGVI 147
            ||.: |...|:|.|..:|| :.:..:||.:|.|  ..|..|.:.|.|.           |...::
plant   105 YGKV-FKTNIIGTPIIIST-DAEVNKVVLQNHGNTFVPAYPKSITELL-----------GENSIL 156

  Fly   148 PTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPDDFIDTINRWT 212
            ...|.......|::...|..|                      .|:|..|.:.....:.|:..|.
plant   157 SINGPHQKRLHTLIGAFLRSP----------------------HLKDRITRDIEASVVLTLASWA 199

  Fly   213 LESVSVVALDKQLGLLKNSNKESEALKLFHYLDEF----FIVSIDLEMKPSPWRYIKTPKLK--- 270
                                    .|.|.|..||.    |.:.:.:.|..||...:...||:   
plant   200 ------------------------QLPLVHVQDEIKKMTFEILVKVLMSTSPGEDMNILKLEFEE 240

  Fly   271 ---------------RLMRALDGIQEVTLAYVDEAIERLDKEAKEGVVRPENEQSVLEKLLK--- 317
                           ||.::|.. :|..:..|.:.:|  :::.......|.|:  |::.||:   
plant   241 FIKGLICIPIKFPGTRLYKSLKA-KERLIKMVKKVVE--ERQVAMTTTSPAND--VVDVLLRDGG 300

  Fly   318 -----------VDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNK- 370
                       |..|:     ::|::.|.:|..:..|..:..|:.||...|:|.||.|::...| 
plant   301 DSEKQSQPSDFVSGKI-----VEMMIPGEETMPTAMTLAVKFLSDNPVALAKLVEENMEMKRRKL 360

  Fly   371 --NSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAGTYVNIVPLNALTR 433
              ..|:......::.:.:..|.|:.|:..:|.|..|...:|..:.||.:|.|..|....::....
plant   361 ELGEEYKWTDYMSLSFTQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWCVLASFISVHMD 425

  Fly   434 DEYFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTAR 498
            ::.:....:|.|.||.|....:.|.           ..|.|||.|.|:|.|..:.::|:.:....
plant   426 EDIYDNPYQFDPWRWDRINGSANSS-----------ICFTPFGGGQRLCPGLELSKLEISIFLHH 479

  Fly   499 LIRNFNVEFNYPTENAFRSALINLPNIPLK 528
            |:..:       :..|....:::.|.:.:|
plant   480 LVTRY-------SWTAEEDEIVSFPTVKMK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 95/485 (20%)
ROT3NP_568002.1 PLN03141 68..515 CDD:215600 95/485 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.