DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and CYP707A1

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_974574.1 Gene:CYP707A1 / 827663 AraportID:AT4G19230 Length:484 Species:Arabidopsis thaliana


Alignment Length:495 Identity:91/495 - (18%)
Similarity:177/495 - (35%) Gaps:135/495 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SMKMSMPGGKYKNMELMEMFEAMRQD-----------YGDIFFMPGIMGNP-PFLSTHNPQDFEV 111
            |.|:.:|.|......:.|.|:...||           ||.: |...::|.| ..:|:.....|.:
plant    31 SSKLPLPPGTMGWPYVGETFQLYSQDPNVFFQSKQKRYGSV-FKTHVLGCPCVMISSPEAAKFVL 94

  Fly   112 VFRNEGVWPNRP-------GNYTLLYHREEYRKDFYQGVMGVIPTQGKPWGDFRTVVNPVLMQ-- 167
            |.::....|..|       |...:.:|:                      ||:...:..::::  
plant    95 VTKSHLFKPTFPASKERMLGKQAIFFHQ----------------------GDYHAKLRKLVLRAF 137

  Fly   168 -PKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPDDFIDTINRW------TLESVSVVALDKQL 225
             |:::|.....:..:.|                      |::..|      |.:.:.....:  :
plant   138 MPESIRNMVPDIESIAQ----------------------DSLRSWEGTMINTYQEMKTYTFN--V 178

  Fly   226 GLLKNSNKES----EALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAY 286
            .||....|:.    |.||..:|:.|....|:.:.:..:.:.        :.|:|...:.::....
plant   179 ALLSIFGKDEVLYREDLKRCYYILEKGYNSMPVNLPGTLFH--------KSMKARKELSQILARI 235

  Fly   287 VDEAIERLDKEAKEGVVRPENEQS--------VLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFT 343
            :.|              |.:|..|        :.:|....|.::|..: :.::.|..|||:|..:
plant   236 LSE--------------RRQNGSSHNDLLGSFMGDKEELTDEQIADNI-IGVIFAARDTTASVMS 285

  Fly   344 ALLLCLAKNPEKQARLREEVMKVLPNK--NSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVL 406
            .:|..||:||.....:.||.|.:..:|  ....|....|.:|.....|:|:.|:..::....|..
plant   286 WILKYLAENPNVLEAVTEEQMAIRKDKEEGESLTWGDTKKMPLTSRVIQETLRVASILSFTFREA 350

  Fly   407 ARDAVLSGYRVPAGTYVNIVPL--NALTRDEYFPQASEFLPERWLRSPKDSESKCPANELKSTNP 469
            ..|....||.:|.|.  .::||  |.....:.|....:|.|.|:..:||               |
plant   351 VEDVEYEGYLIPKGW--KVLPLFRNIHHSADIFSNPGKFDPSRFEVAPK---------------P 398

  Fly   470 FVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNY 509
            ..|:|||.|...|.|..:.::|:.:    :|.:...::.:
plant   399 NTFMPFGNGTHSCPGNELAKLEMSI----MIHHLTTKYRF 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 87/482 (18%)
CYP707A1NP_974574.1 PLN02196 1..464 CDD:177847 91/495 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.