DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and DWF4

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_190635.1 Gene:DWF4 / 824229 AraportID:AT3G50660 Length:513 Species:Arabidopsis thaliana


Alignment Length:546 Identity:108/546 - (19%)
Similarity:200/546 - (36%) Gaps:148/546 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KMSMPGGK---------------YKNMELMEMFEAMRQDYGDIFFMPGIMGNPPFLSTHNPQDFE 110
            :.::|.||               |....|.:..:.....||.| :...:.|.|..:|.....: .
plant    36 RFNLPPGKSGWPFLGETIGYLKPYTATTLGDFMQQHVSKYGKI-YRSNLFGEPTIVSADAGLN-R 98

  Fly   111 VVFRNEG-----VWPNRPGNYTLLYHREEYRKDFYQGVMGVIPTQGKPW------GDFRTVVNPV 164
            .:.:|||     .:|...|                 |::|       .|      ||.       
plant    99 FILQNEGRLFECSYPRSIG-----------------GILG-------KWSMLVLVGDM------- 132

  Fly   165 LMQPKNVRLYYKKMSQVNQEFVQ----RILELRDPDTLEAPDDFIDTINRWTLESV--------- 216
                      ::.|..::..|:.    |.:.|:|   :|....|:  ::.|...|:         
plant   133 ----------HRDMRSISLNFLSHARLRTILLKD---VERHTLFV--LDSWQQNSIFSAQDEAKK 182

  Fly   217 -SVVALDKQLGLLKNSNKESEALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQ 280
             :...:.|.:..:....:|:|.||..:......:||..|.:..:.:.           :||.. :
plant   183 FTFNLMAKHIMSMDPGEEETEQLKKEYVTFMKGVVSAPLNLPGTAYH-----------KALQS-R 235

  Fly   281 EVTLAYVDEAIE--RLD---KEAKEGVVRPENE---------------QSVLEKLLKVDRKVATV 325
            ...|.:::..:|  :||   ::.:|..|:.|:|               ..:|..:|| ...::|.
plant   236 ATILKFIERKMEERKLDIKEEDQEEEEVKTEDEAEMSKSDHVRKQRTDDDLLGWVLK-HSNLSTE 299

  Fly   326 MAMD----MLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNK----NSEFTEASMKNV 382
            ..:|    :|.||.:|:|......:..|...|:....||||.:::...|    .||......|.:
plant   300 QILDLILSLLFAGHETSSVAIALAIFFLQACPKAVEELREEHLEIARAKKELGESELNWDDYKKM 364

  Fly   383 PYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAGTYVNIVP-LNALTRD-EYFPQASEFLP 445
            .:.:..|.|:.||..::....|...:|....||.:|:|.  .::| ::|:..| ..:.|.:.|.|
plant   365 DFTQCVINETLRLGNVVRFLHRKALKDVRYKGYDIPSGW--KVLPVISAVHLDNSRYDQPNLFNP 427

  Fly   446 ERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNYP 510
            .||.:....:.|.  .:...||....::|||.|||:|.|..:.::|:.:....|:..||.|....
plant   428 WRWQQQNNGASSS--GSGSFSTWGNNYMPFGGGPRLCAGSELAKLEMAVFIHHLVLKFNWELAED 490

  Fly   511 TENAFRSALINLPNIPLKFKFIDLPN 536
            .:             |..|.|:|.||
plant   491 DK-------------PFAFPFVDFPN 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 100/513 (19%)
DWF4NP_190635.1 PLN02500 29..513 CDD:215276 108/546 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.