DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and CYP710A4

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_180452.1 Gene:CYP710A4 / 817435 AraportID:AT2G28860 Length:493 Species:Arabidopsis thaliana


Alignment Length:490 Identity:107/490 - (21%)
Similarity:183/490 - (37%) Gaps:136/490 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GDIFFMPGIMGNPPFLSTHNPQDFEVVFRNEGVWPNRPG----------NYT----LLYHRE--- 133
            |.:|..| |:||...| ..:|..|         |..:..          ||.    ::|.::   
plant    39 GPLFVFP-IIGNVVAL-IRDPTSF---------WDKQSAMADTSVGLSVNYLIGKFIIYIKDAEL 92

  Fly   134 ------EYRKDFYQGVMGVIPTQGKPWG---------------DFRTVVNPVLMQPKNVRLYYKK 177
                  ..|.|.:|       ..|.|:|               |.::|...|  .|...|   |.
plant    93 SNKVLSNIRPDAFQ-------LTGHPFGKKLFGDHSLIFMFGEDHKSVRRQV--APNFTR---KP 145

  Fly   178 MSQVNQEFVQRILELRDPDTLEAPDDFIDTINRWTLES-------VSVVALDKQLGLLKNSNKES 235
            :|..:.  :|:|:.||.             :.:|. ||       ||:..|.::|.|     :.|
plant   146 LSAYSS--LQQIVILRH-------------LRQWE-ESFSSGSRPVSMRQLIRELNL-----ETS 189

  Fly   236 EALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDK---- 296
            :.:.:..|||:        |:|.:.........|..:...:| :...|.....:|:.||..    
plant   190 QTVFVGPYLDK--------EVKKTICDDYSLLTLGTMAIPID-LPGFTFGEARQAVSRLVNTMSV 245

  Fly   297 ---EAKEGVVRPEN--------EQSVLEK----LLKVDRKVATVMAMDMLMAGVDTTSSTFTALL 346
               ::|..:...||        ..|::|:    ....|::::.|: :|.:.|..|.::|:....:
plant   246 CVGKSKAKMAAGENPTCLVDFWTHSIIEENPPPPHSKDKEISCVL-VDFMFASQDASTSSLLWAV 309

  Fly   347 LCLAKNPEKQARLREEVMKVLPNKNSE-FTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDA 410
            :.|...||...|:||:|.:...::::| .|...:..:.|.||..:|..|..|.......|...|.
plant   310 VMLESEPEVLRRVREDVARFWSSESNELITADQLAEMKYTRAVAREVLRYRPPASMIPHVAVSDF 374

  Fly   411 VLS-GYRVPAGTYVNIVPLNALTRDEYFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLP 474
            .|: .|.:|.||.|  .|.......:.|.:...|.|:|:      ||:: ..:|:...|   ||.
plant   375 RLTESYTIPKGTIV--FPSLFDASFQGFTEPDRFDPDRF------SETR-QEDEVFKRN---FLT 427

  Fly   475 FGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNY 509
            ||.|...|||:|.....|.|    .|..|:..|::
plant   428 FGNGSHQCVGQRYAMNHLVL----FIAMFSSMFDF 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 107/490 (22%)
CYP710A4NP_180452.1 p450 38..459 CDD:299894 107/490 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.