DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and CYP710A3

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_180451.1 Gene:CYP710A3 / 817434 AraportID:AT2G28850 Length:493 Species:Arabidopsis thaliana


Alignment Length:479 Identity:101/479 - (21%)
Similarity:179/479 - (37%) Gaps:123/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IFFMPGIMGNPPFLSTHNPQDFEVVFRNEGVWPNRP------GNYTLLY-----HREEYRKDFYQ 141
            |:.....:.|..| |...|..|::|        ..|      |:::|::     |:...|:    
plant    85 IYIKDAELSNKVF-SNIRPDAFQLV--------GHPFGKKLFGDHSLIFMFGENHKSVRRQ---- 136

  Fly   142 GVMGVIPT-QGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPDDFI 205
                |.|. ..||...:.::...|::  :::|.:.:..|..::....|.|              |
plant   137 ----VAPNFTRKPLSAYSSLQQIVIL--RHLRQWEESFSSGSRPVSMRQL--------------I 181

  Fly   206 DTINRWTLESVSV-VALDKQLGLLKNSNKESEALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKL 269
            ..:|..|.::|.| ..|||:   :||:.:           |::.:.:               |..
plant   182 RELNLETSQTVFVGPYLDKE---VKNTIR-----------DDYNVFN---------------PGT 217

  Fly   270 KRLMRALDGIQEVTLAYVDEAIERL-------DKEAKEGVVRPENEQSVLEKLL----------- 316
            ..|...|.|.   |......|:.||       .:::||.:...||...:::...           
plant   218 MALPIDLPGF---TFGEARRAVSRLVNTMSLCVRKSKEKMAAGENPTCLVDFWTHSIVAESPPPP 279

  Fly   317 -KVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKV-LPNKNSEFTEASM 379
             ..|.:::.|: :|.|.|..|.::|:....::.|...||...|:||:|.:. .|......|...:
plant   280 HSKDEEISCVL-VDFLFASQDASTSSLLWAVVLLESEPEVLRRVREDVARFWSPESKESITADQL 343

  Fly   380 KNVPYLRACIKESQRLHPLIVGNARVLARDAVLS-GYRVPAGTYVNIVPLNALTRDEYFPQASEF 443
            ..:.|:||..:|..|..|.......|...|..|: .|.:|.||.|  .|.......:.|.:...|
plant   344 AEMKYIRAVAREVLRYRPPASMVPHVAVSDFRLTESYTIPKGTIV--FPSLFDASFQGFTEPDRF 406

  Fly   444 LPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFN 508
            .|:|:      ||:: ..:|:...|   ||.||.|...|||:|.....|.|    .|..|:..|:
plant   407 DPDRF------SETR-QEDEVFKRN---FLTFGIGSHQCVGQRYALNHLVL----FIAMFSSMFD 457

  Fly   509 YPTENAFRS----ALINLPNIPLK 528
            :   ...||    .::::|.:..|
plant   458 F---KRVRSDGCDEIVHIPTMSPK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 101/479 (21%)
CYP710A3NP_180451.1 p450 38..459 CDD:299894 97/458 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.