DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:463 Identity:101/463 - (21%)
Similarity:189/463 - (40%) Gaps:78/463 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AMRQDYGDIFFMPGI--MGNPPFLSTHNPQDFEVVF-----RNEGVWPNRPGNYTLLYHREEYRK 137
            ::|..|.||:....:  :|..||:.|.:|:..|.:|     .|.....::|.|        ....
  Fly    56 SIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVN--------SCTG 112

  Fly   138 DFYQGVMGVIPTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPD 202
            |      |::..:...|.|.|..:||...|  ||.|.:  :...|.| .:.::...|....:...
  Fly   113 D------GLLSLEASKWVDRRKNLNPAFKQ--NVLLSF--LPIFNSE-AKTLVAFLDSLVGQGEK 166

  Fly   203 DFIDTINRWTLESVSVVALDKQLG--LLKNSN-KESEALKLFHYLDEFFIVSIDLEMKPSPWRYI 264
            ...|.|.||:..    :|....:|  :.|::: |....||.:....:..::::.|     |:.: 
  Fly   167 KVRDDIVRWSFR----IATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLL-----PFTH- 221

  Fly   265 KTPKLKRLMRALDGIQEVTLAYVDEAIERL-----DKEAKEGVVRPENEQ-----SVLEKLL--- 316
                 .::...|.|. |...|.....:.::     ||:.   :.:||:..     ||:.|.:   
  Fly   222 -----NKIFSTLGGF-ETQKALAKSNVNKMIGTIVDKKL---MTKPESGSQPEITSVINKAIELH 277

  Fly   317 ---KVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKNS-EFTEA 377
               ::.|:.........::|..:||..|....|:.||..||.|..:.:|:.::.|.... |.|..
  Fly   278 RNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYD 342

  Fly   378 SMKNVPYLRACIKESQRLHPLIVGNARVLARDAVL-SGYRVPAGTYVNI-VPLNALTRDEYFPQA 440
            .::.:.:|...:.|:.||.|.:....|...||..| ||..:|.|..:.| :......||.:....
  Fly   343 DLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDP 407

  Fly   441 SEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNV 505
            |.|.|:.:|          |.| ::..:|:.::||..|.|.|:|.:...|..:|..::::||..|
  Fly   408 SSFNPDHFL----------PDN-VRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKV 461

  Fly   506 EFNYPTEN 513
            ..::..|:
  Fly   462 STSFRYED 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 101/463 (22%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 100/455 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.