DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:571 Identity:128/571 - (22%)
Similarity:211/571 - (36%) Gaps:145/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WLQAKPFEQIPRLNMW-------ALSMKMSMPGGKYKNMELMEMFEAMRQDYGDIFFMP--GIMG 96
            |.|.|.:..|.:||.|       .|.:.:.:      |:....:.|.:.| |...|..|  .::|
  Fly    20 WQQRKCWRLIWQLNGWRGVIQQPVLWLLLCI------NLHPNSILEKVSQ-YRVHFQRPLAVLVG 77

  Fly    97 NPPFLSTHNPQDFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGVM----GVIPTQGKPWGDF 157
            ....|...:|...|.|.       |.|         |...|.|.|...    |::..:|:.|...
  Fly    78 TRVLLYIDDPAGMECVL-------NAP---------ECLDKTFLQDGFFVRRGLLHARGQKWKLR 126

  Fly   158 RTVVNPVLMQPKNVRLYYKKMSQVNQEFVQR------------------------ILELRDPDTL 198
            |..:||.... ..|..::...:.|..:.|::                        :||:.....:
  Fly   127 RKQLNPAFSH-NIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIM 190

  Fly   199 EAPDDFIDTINRWTLES------VSVVALDK---QLGLLKN---SNKESEALKLFHYLDEFFIVS 251
            ..|.:|....:.....|      :|.|.:.|   |:.||..   .....|:.|....|::|  |.
  Fly   191 GTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDF--VG 253

  Fly   252 IDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDKEAKEGVVR----------PE 306
            ..:..|...|         ||..|:.|             |:..::|..|..|          ..
  Fly   254 GIVRTKHRNW---------RLRDAVGG-------------EKSGEDASNGWQRRIFIEQIFQLAA 296

  Fly   307 NEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNP-EKQARLREEVMKVLPNK 370
            |.:..||:::.        .|..|::...:|.|::....|||||.|. :.|.||..|:..::|:.
  Fly   297 NGEMTLEEIMD--------EAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDV 353

  Fly   371 NSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAGTYVNIVPLNALT--- 432
            .....| .::.:.||.|.:.||.||...:..|.|.::||     :|:....:..|||.|::.   
  Fly   354 GQVGLE-QLQQLRYLDAFVSESLRLLATVPMNLRHVSRD-----FRLAGRQHETIVPQNSIVVLD 412

  Fly   433 -----RDE--YFPQASEFLPERWL--------RSPKDSESKCPANELKSTNPFVFLPFGFGPRMC 482
                 |||  :...|.:|.|:|:|        :...||.|.....:....:.:.||||..|.|.|
  Fly   413 TFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSC 477

  Fly   483 VGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALINLPNIPLKFKFID 533
            :|:|.....:::...:||.||:.:.::..|.     |..:.||.||||..|
  Fly   478 IGRRYGLFIMKVFLVKLITNFDFQSDFELEK-----LQFVENISLKFKNAD 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 117/529 (22%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 112/522 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.