DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a4 and CYP27B1

DIOPT Version :9

Sequence 1:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000776.1 Gene:CYP27B1 / 1594 HGNCID:2606 Length:508 Species:Homo sapiens


Alignment Length:457 Identity:124/457 - (27%)
Similarity:209/457 - (45%) Gaps:69/457 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PQDFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGVMGVIPTQGKPWGDFRTVVNPVLMQPKN 170
            |...|.:.|.||..|.|........||.     ..|...|::..:|:.|...|:::.|:|::|:.
Human    91 PALVEELLRQEGPRPERCSFSPWTEHRR-----CRQRACGLLTAEGEEWQRLRSLLAPLLLRPQA 150

  Fly   171 VRLYYKKMSQVNQEFVQRILELRDPDTLEAPD----DFIDTINRWTLESVSVVALDKQLGLLKNS 231
            ...|...::.|..:.|:|:...|...|  .|.    |......::.||.::.|.|..:||.|: :
Human   151 AARYAGTLNNVVCDLVRRLRRQRGRGT--GPPALVRDVAGEFYKFGLEGIAAVLLGSRLGCLE-A 212

  Fly   232 NKESEALKLFHYLDEFFIVSIDLEMK---------PSPWRYIKTPKLKRLMRALDGIQEVTLAYV 287
            ....:.......:...|:.:: |.|.         |.||        .||.|..|.:    .|:.
Human   213 QVPPDTETFIRAVGSVFVSTL-LTMAMPHWLRHLVPGPW--------GRLCRDWDQM----FAFA 264

  Fly   288 DEAIERLDKEA--KEGVVRPENEQSVLEK-------LLKVDRKVATVM--AMDMLMAGVDTTSST 341
            ...:||.:.||  :.| .:||.:   ||.       |.:.:....:::  ..::|:|||||.|:|
Human   265 QRHVERREAEAAMRNG-GQPEKD---LESGAHLTHFLFREELPAQSILGNVTELLLAGVDTVSNT 325

  Fly   342 FTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEAS-MKNVPYLRACIKESQRLHPLIVGNARV 405
            .:..|..|:::||.|..|..|:...|...:|.:..|: :..:|.|:|.:||..||:|::.||:||
Human   326 LSWALYELSRHPEVQTALHSEITAALSPGSSAYPSATVLSQLPLLKAVVKEVLRLYPVVPGNSRV 390

  Fly   406 LARDAVLSGYRVPAGTYVNIVPLNALTRD-EYFPQASEFLPERWLRSPKDSESKCPANELKSTNP 469
            ..:|..:..|.:|..|.|.:... |.:|| ..||:.:.|.|.|||     .|...|       :|
Human   391 PDKDIHVGDYIIPKNTLVTLCHY-ATSRDPAQFPEPNSFRPARWL-----GEGPTP-------HP 442

  Fly   470 FVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFN---YPTENAFRSALINLPNIPLKFKF 531
            |..||||||.|.|:|:|:.|:||::..|:::.:|.|:..   .|.....|:.|:  |...:..:|
Human   443 FASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLV--PERSINLQF 505

  Fly   532 ID 533
            :|
Human   506 LD 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 122/453 (27%)
CYP27B1NP_000776.1 p450 41..505 CDD:278495 122/453 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48087
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.