DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP86C3

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_172773.4 Gene:CYP86C3 / 837871 AraportID:AT1G13140 Length:534 Species:Arabidopsis thaliana


Alignment Length:467 Identity:94/467 - (20%)
Similarity:201/467 - (43%) Gaps:100/467 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGV--QGIIPS 149
            |.|:|.|..|    .:|..|.:.|.:.:          ::...:.:..:.|:.|:.:  .||..:
plant    83 NGIWLGGSYG----AVTCVPANVEYMLK----------TNFKNFPKGAFFKERFNDLLEDGIFNA 133

  Fly   150 QGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFV--ELIKEIRDASTQEVPGNFLETINRWT 212
            ..:||.:.|.|:...:...:.|...|    |..|:.|  :|:|.:...:..:...:..:.:.|.|
plant   134 DAESWKEQRRIIITEMHSTRFVEHSF----QTTQDLVRKKLLKVMESFARSQEAFDLQDVLLRLT 194

  Fly   213 LESVSVV-------ALDKQLGLLRESGKNSEATK--LFKYLDEFFLHSADLEMKPSLW---RYFK 265
            .:::.:.       .||..|.|:..:....|||:  :|:::           :.|.:|   ::|.
plant   195 FDNICIAGLGDDPGTLDSDLPLVPFAQAFEEATESTMFRFM-----------IPPFIWKPLKFFD 248

  Fly   266 TPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKV-------DKKVA 323
            ....|.:.:.:|.|.|...|.|.:.|.:|::|...|     :...||.:::::       :|..:
plant   249 IGYEKGLRKAVDVVHEFVDKMVVDRICKLKEEGTLG-----NRSDVLSRIIEIESHKTTDEKDPS 308

  Fly   324 TV-----MAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNK--------DSEFT 375
            |:     .....::||.||:|...|.....:.|:||.:.::..|:.::|..:        :|.||
plant   309 TIKFFRQFCTSFILAGRDTSSVALTWFFWVIQKHPEVENKIIREISEILRQRGDSPTSKNESLFT 373

  Fly   376 EASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIV-----------SMIPIN 429
            ...:.::.||:|.:.|:.|:||.:....:....|.|.     |.||.:           :|..:.
plant   374 VKELNDMVYLQAALSETMRLYPPIPMEMKQAIEDDVF-----PDGTFIRKGSRVYFATYAMGRME 433

  Fly   430 SLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELEL 494
            |::.::.    ..|.||||:::.:.      .||    :.|.::.|..|||:|:||....::::.
plant   434 SIWGKDC----ESFKPERWIQSGNF------VND----DQFKYVVFNAGPRLCLGKTFAYLQMKT 484

  Fly   495 GTARLIRNFNVE 506
            ..|.::..::::
plant   485 IAASVLSRYSIK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 94/467 (20%)
CYP86C3NP_172773.4 CYP86A 80..517 CDD:410687 94/467 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.