DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP94B1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001331365.1 Gene:CYP94B1 / 836464 AraportID:AT5G63450 Length:568 Species:Arabidopsis thaliana


Alignment Length:532 Identity:120/532 - (22%)
Similarity:214/532 - (40%) Gaps:77/532 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PIVFSASQQRWQTNVPTAEIRNDP-EWLQAKPFEEIPKANILSLF--------AKSALPG----- 66
            |:....:.|....|:|..|.:... |.|.|......|....:.:|        ||:|.|.     
plant    35 PLQIKNTNQNNIINLPKQETQESKMEMLNAIILILFPIIGFVLIFSFPTKTLKAKTASPSNPTSY 99

  Fly    67 ---------GKYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPF- 121
                     .|.::..:....|.||......|.:..:.|| ..::|.||::.|.:.:. ..:.| 
plant   100 QLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITVDLLFGR-RTIITANPENVEHILKT-NFYNFP 162

  Fly   122 --RPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKM-SQVNQ 183
              :|.:|:|        .|...|  ||..|.|:.|...|.:.:............|:.: .:|..
plant   163 KGKPFTDLL--------GDLLGG--GIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEVQN 217

  Fly   184 EFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFF 248
            ..:.::....|.....   :|.|.:.|:..:.|..|:|......|..:....|..|.|....|. 
plant   218 RLIPVLSSAVDCGETV---DFQEVLKRFAFDVVCKVSLGWDPDCLDLTRPVPELVKAFDVAAEI- 278

  Fly   249 LHSADLEMKP--SLWRYFKTPLLKKML------RTMDSVQEVTLKYVDEAIERLEKEAKEGVVRP 305
              ||....:|  ::|:      :|:.|      |..::::.|.|. |.|.| |.:|::.:.....
plant   279 --SARRATEPVYAVWK------VKRFLNVGSEKRLREAIKTVHLS-VSEII-RAKKKSLDIGGDV 333

  Fly   306 EHEQSVLEKLLKV--DKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLP 368
            ..:|.:|.:.|..  .::......:..:|||.||||:..|.|...|::|.:.:.::.:|    |.
plant   334 SDKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVETKILDE----LR 394

  Fly   369 NKDS---EFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVI-SGYRVPAGTIVSMIPIN 429
            ||.|   .|.:  ::.:.|.:||:.|:.|:||.|..:::....|.:: .|..:..|..|:..|..
plant   395 NKGSLGLGFED--LREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDGTPLKKGDKVTYFPYG 457

  Fly   430 SLYSEEYFPKP-TEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELE 493
            ....|:.:.|. .||.|.||... ..|.|..|.  ||:.:.|.|..|..|||:|:||.:...:::
plant   458 MGRMEKVWGKDWDEFKPNRWFEE-EPSYGTKPV--LKSVSSFKFPVFQAGPRVCIGKEMAFTQMK 519

  Fly   494 LGTARLIRNFNV 505
            .....::..|.:
plant   520 YVVGSVLSRFKI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 104/444 (23%)
CYP94B1NP_001331365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.