DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and ROT3

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_568002.1 Gene:ROT3 / 829790 AraportID:AT4G36380 Length:524 Species:Arabidopsis thaliana


Alignment Length:483 Identity:95/483 - (19%)
Similarity:181/483 - (37%) Gaps:110/483 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IDALRQDYG-----NIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRK 137
            :|..:..||     |||..|.::..|..|.       :||.:|.|. .|.|          .|.|
plant    98 MDKRKSLYGKVFKTNIIGTPIIISTDAEVN-------KVVLQNHGN-TFVP----------AYPK 144

  Fly   138 DFFD--GVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEV 200
            ...:  |...|:...|.......:::...|..|                      .::|..|:::
plant   145 SITELLGENSILSINGPHQKRLHTLIGAFLRSP----------------------HLKDRITRDI 187

  Fly   201 PGNFLETINRW-------TLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMKP 258
            ..:.:.|:..|       ..:.:..:..:..:.:|..:....:...|....:||......:.:|.
plant   188 EASVVLTLASWAQLPLVHVQDEIKKMTFEILVKVLMSTSPGEDMNILKLEFEEFIKGLICIPIKF 252

  Fly   259 SLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLK------ 317
            ...|.:|:...|:.|          :|.|.:.:|  |::.......|.::  |::.||:      
plant   253 PGTRLYKSLKAKERL----------IKMVKKVVE--ERQVAMTTTSPAND--VVDVLLRDGGDSE 303

  Fly   318 --------VDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNK---D 371
                    |..|:     ::|::.|.:|..:..|..:..|:.||...|:|.||.|::...|   .
plant   304 KQSQPSDFVSGKI-----VEMMIPGEETMPTAMTLAVKFLSDNPVALAKLVEENMEMKRRKLELG 363

  Fly   372 SEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEY 436
            .|:......::.:.:..|.|:.|:..::.|..|...:|..|.||.:|.|..|....|:....|:.
plant   364 EEYKWTDYMSLSFTQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWCVLASFISVHMDEDI 428

  Fly   437 FPKPTEFLPERWLR-NASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLI 500
            :..|.:|.|.||.| |.|.::..|            |.|||.|.|:|.|..:.::|:.:....|:
plant   429 YDNPYQFDPWRWDRINGSANSSIC------------FTPFGGGQRLCPGLELSKLEISIFLHHLV 481

  Fly   501 RNFNVEFNHSTKNAFRSALINLPNIPLK 528
            ..:       :..|....:::.|.:.:|
plant   482 TRY-------SWTAEEDEIVSFPTVKMK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 94/480 (20%)
ROT3NP_568002.1 PLN03141 68..515 CDD:215600 95/483 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.