DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP707A4

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_566628.1 Gene:CYP707A4 / 821461 AraportID:AT3G19270 Length:468 Species:Arabidopsis thaliana


Alignment Length:533 Identity:111/533 - (20%)
Similarity:177/533 - (33%) Gaps:168/533 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LQSQKPIVFSASQQRWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFAKSALPGGKYKNLEMM 75
            |.||.|.||..|:|                    |.:.||.|..||.           |..: |:
plant    50 LYSQNPNVFFTSKQ--------------------KRYGEIFKTRILG-----------YPCV-ML 82

  Fly    76 EMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFF 140
            ...:|.|                .:::||             ...|:|     .|.|:   |:..
plant    83 ASPEAAR----------------FVLVTH-------------AHMFKP-----TYPRS---KEKL 110

  Fly   141 DGVQGIIPSQGKSWGDFRSIVNPVLMQ---PKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPG 202
            .|...:...|    ||:.|.:..::..   |:.:|              :||.:|...:      
plant   111 IGPSALFFHQ----GDYHSHIRKLVQSSFYPETIR--------------KLIPDIEHIA------ 151

  Fly   203 NFLETINRW-------TLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLEMK--- 257
              |.::..|       |.:.:...|.|  :|:|...|....:.|      |...|:.::..|   
plant   152 --LSSLQSWANMPIVSTYQEMKKFAFD--VGILAIFGHLESSYK------EILKHNYNIVDKGYN 206

  Fly   258 ------PSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAI-ERLEKEAKEGVVRPEHEQSVLEKL 315
                  |.. .|.|..:.:|.|:|:          |.|.| ||.||.|.        :...|..|
plant   207 SFPMSLPGT-SYHKALMARKQLKTI----------VSEIICERREKRAL--------QTDFLGHL 252

  Fly   316 LKVDKKVATVMAMD--------MLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDS 372
            |....:...|:..:        :|.|..|||:|..|.:|..|..:.:....::.|...:......
plant   253 LNFKNEKGRVLTQEQIADNIIGVLFAAQDTTASCLTWILKYLHDDQKLLEAVKAEQKAIYEENSR 317

  Fly   373 E---FTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSE 434
            |   .|....:|:|.....|.||.|:..::....|....|....||.:|.|..|..:..|..::.
plant   318 EKKPLTWRQTRNMPLTHKVIVESLRMASIISFTFREAVVDVEYKGYLIPKGWKVMPLFRNIHHNP 382

  Fly   435 EYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARL 499
            :||..|..|.|.|:..|               ..|..|:|||.|...|.|..:.::::.:....|
plant   383 KYFSNPEVFDPSRFEVN---------------PKPNTFMPFGSGVHACPGNELAKLQILIFLHHL 432

  Fly   500 IRNFNVEFNHSTK 512
            :.||..|.....|
plant   433 VSNFRWEVKGGEK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 94/463 (20%)
CYP707A4NP_566628.1 p450 6..467 CDD:299894 111/533 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.