DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP86A8

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_182121.1 Gene:CYP86A8 / 819205 AraportID:AT2G45970 Length:537 Species:Arabidopsis thaliana


Alignment Length:487 Identity:117/487 - (24%)
Similarity:208/487 - (42%) Gaps:92/487 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALPGGKYKNLEMME--MIDALRQDYGN----IIFLPGMMGRDGLV-MTHNPKDFEVVFRNE-GVW 119
            :|| |..:|.|.|.  :.|.||...|.    |..:|.:..:.||| :|.:|::.|.:.:|. ..:
plant    38 SLP-GLIENCERMHDWISDNLRACSGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNY 101

  Fly   120 PFRPGSDILRYHRTVYRKDFFDGV-QGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYF--KKMSQV 181
            |..|          .::..|.|.: |||..|.|.:|          |.|.|...|.|  :.:.|.
plant   102 PKGP----------TWQAVFHDLLGQGIFNSDGDTW----------LFQRKTAALEFTTRTLRQA 146

  Fly   182 NQEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRES------GKNSEATKL 240
            ...:|....::|          ||..:....|.|..:...|..|.|..::      ||:......
plant   147 MARWVNRAIKLR----------FLPILENARLGSEPIDLQDLLLRLTFDNICGLTFGKDPRTCAP 201

  Fly   241 FKYLDEFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTL--------KYVDEAIERLEKE 297
            ...::.|.: :.|...:.||.|:....:|.|..|.:....||:|        .|:.|.|...::|
plant   202 GLPVNTFAV-AFDRATEASLQRFILPEILWKFKRWLRLGLEVSLTRSLVQVDNYLSEIITTRKEE 265

  Fly   298 AKEGVVRPEHEQSVLEKLLK-----VDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQA 357
            ........:|...:|.:.:|     .|:.:..| |::.::||.||:|...:.....:.::|..:.
plant   266 MMTQHNNGKHHDDLLSRFIKKKESYSDETLQRV-ALNFILAGRDTSSVALSWFFWLITQHPAIED 329

  Fly   358 RLREEVMKVLPN---------KDSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVI- 412
            ::..|:..||..         .|...:...:..:.:|:|.:.|:.|:||.|..:::...:|.|: 
plant   330 KILREICTVLVETRGDDVALWTDEPLSCEELDRLVFLKAALSETLRLYPSVPEDSKRAVKDDVLP 394

  Fly   413 SGYRVPAGTIVSMIPINSLYSEEYFPKPT------EFLPERWLRNASDSAGKCPANDLKTKNPFV 471
            .|..||||:.::.    |:||.... |.|      ||.||||:  :....|:...:|     ||.
plant   395 DGTFVPAGSSITY----SIYSAGRM-KSTWGEDCLEFKPERWI--SQSDGGRFINHD-----PFK 447

  Fly   472 FLPFGFGPRMCVGKRIVEMELE-LGTARLIRN 502
            |:.|..|||:|:||.:..:::: :.:|.|:|:
plant   448 FVAFNAGPRICLGKDLAYLQMKSIASAVLLRH 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 110/467 (24%)
CYP86A8NP_182121.1 CYP86A 67..503 CDD:410687 107/457 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.