DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP718

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_181813.1 Gene:CYP718 / 818885 AraportID:AT2G42850 Length:485 Species:Arabidopsis thaliana


Alignment Length:479 Identity:101/479 - (21%)
Similarity:184/479 - (38%) Gaps:103/479 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 RYHRTVYRKDFFDGVQGIIPSQ-GKSW-GD-------------FRSIVNPVLMQPKNV---RLYF 175
            ::||.:.:|  ....:.::|.: |..| |:             |...|||.:::..|:   |:..
plant    30 KHHRFITKK--IQKKKKLLPGEMGLPWIGETMDFYKAQKSNRVFEDFVNPRIIKHGNIFKTRIMG 92

  Fly   176 KKMSQVN----------QEFVELIKEIRDASTQEVPGNFL--------ETINRWTLESVSVVALD 222
            .....||          .||..::.....:|.|.:..|.:        ..:......|:|.:.|:
plant    93 SPTIVVNGAEANRLILSNEFSLVVSSWPSSSVQLMGMNCIMAKQGEKHRVLRGIVANSLSYIGLE 157

  Fly   223 ---------------------KQLGLLRESGKNSEATKLFKYLDEFFLHSADLEM-KPSLWRYFK 265
                                 :::.|.| |.|....|.:|:.|....:....||: :..|...|.
plant   158 SLIPKLCDTVKFHHETEWRGKEEISLYR-SAKVLTFTVVFECLYGIKVEIGMLEVFERVLEGVFA 221

  Fly   266 TPL---LKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHE--QSVLEKLLK---VDKKV 322
            .|:   ..|..|...:..|:....|.:..|:..:..|||..:|...  ..::|:|:|   .:::|
plant   222 LPVEFPCSKFARAKKARLEIETFLVGKVREKRREMEKEGAEKPNTTLFSRLVEELIKGVITEEEV 286

  Fly   323 ATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNK-DSEF-TEASMKNVPYL 385
            ...|.: ::.|..||||...:.....||::|..:..|.:|..::..|| :.|: |...:|.:.|.
plant   287 VDNMVL-LVFAAHDTTSYAMSMTFKMLAQHPTCRDTLLQEHAQIKANKGEGEYLTVEDVKKMKYS 350

  Fly   386 RACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLR 450
            ...::|:.|:.|.:.|:.|....|....||.:|.|..:......:.|:.|.|..|..|.|.|:  
plant   351 WQVVRETMRLSPPIFGSFRKAVADIDYGGYTIPKGWKILWTTYGTHYNPEIFQDPMSFDPTRF-- 413

  Fly   451 NASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAF 515
                        | |....:.:||||.|||:|.|.::.::.:            :.|.|.....|
plant   414 ------------D-KPIQAYTYLPFGGGPRLCAGHQLAKISI------------LVFMHFVVTGF 453

  Fly   516 RSALI----NLPNIPLKFKFTDVP 535
            ..:|:    .:...||.|....:|
plant   454 DWSLVYPDETISMDPLPFPSLGMP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 100/473 (21%)
CYP718NP_181813.1 CYP90-like 78..482 CDD:410669 90/429 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.