DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP710A1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_180997.1 Gene:CYP710A1 / 818013 AraportID:AT2G34500 Length:495 Species:Arabidopsis thaliana


Alignment Length:177 Identity:48/177 - (27%)
Similarity:79/177 - (44%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 DKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKV-LPNKDSEFTEASMKNV 382
            |:::..:: .|.|.|..|.::|:....:..|...||...|:||||.|: .|..::..|...:..:
plant   282 DEEIGGLL-FDFLFAAQDASTSSLLWAVTLLDSEPEVLNRVREEVAKIWSPESNALITVDQLAEM 345

  Fly   383 PYLRACIKESQR------VYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEY--FPK 439
            .|.|:..:|..|      :.|.|......||..     |.:|.||||    ..|::...:  |.:
plant   346 KYTRSVAREVIRYRPPATMVPHVAAIDFPLTET-----YTIPKGTIV----FPSVFDSSFQGFTE 401

  Fly   440 PTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKR 486
            |..|.|:|:.....:       :.:..:|   ||.||:||..|||:|
plant   402 PDRFDPDRFSETRQE-------DQVFKRN---FLAFGWGPHQCVGQR 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 48/177 (27%)
CYP710A1NP_180997.1 CYP61_CYP710 72..480 CDD:410703 48/177 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.