DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and CYP71A12

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_180633.3 Gene:CYP71A12 / 817626 AraportID:AT2G30750 Length:497 Species:Arabidopsis thaliana


Alignment Length:488 Identity:113/488 - (23%)
Similarity:204/488 - (41%) Gaps:100/488 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KSALPGGKYK-----NLEMMEM-----IDALRQDYGNIIFL-----PGMMGRDGLVMTHNPKDFE 110
            |..||...::     ||..:.:     :.:|...||.::.|     |.::...|.......|..:
plant    30 KVNLPPSPWRLPLIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHD 94

  Fly   111 VVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGII-PSQGKSWGDFRSIVNPVLMQPKNVRLY 174
            :.|.|      ||.|..:.        ...:|.:.:: ...|:.|...:|:....|:..|.| ..
plant    95 LKFAN------RPRSKAVH--------GLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMV-AS 144

  Fly   175 FKKMSQVNQEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSE--- 236
            |:|:.:  :|..|:||::..||:.....|..|.......:..|.:||.:         |:||   
plant   145 FEKIRE--EELNEMIKKLEKASSSSSSENLSELFVTLPSDVTSRIALGR---------KHSEDET 198

  Fly   237 -------ATKLFKYLDEFFLHSADLEMKPSL-WRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIER 293
                   ..::.:.|.||.:.    :..|:| |       :.::......::||:..:.|    .
plant   199 ARDLKKRVRQIMELLGEFPIG----DYVPALAW-------IDRINGFNARIKEVSQGFSD----L 248

  Fly   294 LEKEAKEGVVRPEHEQSVLEKLLKVDKKVA----------TVMAMDMLMAGVDTTSSTFTALLLC 348
            ::|..:|.:....|::..::.||.::.:.:          ..|.:||.:.|..|:|:....::..
plant   249 MDKVVQEHLEAGNHKEDFVDILLSIESEKSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTE 313

  Fly   349 LAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVY---PLVIGNARGLTRDS 410
            |.:||....:|::|:...:....|...|..::|:.||:|.|||..||:   ||::  .|.|:.|.
plant   314 LIRNPNVMKKLQDEIRSTIRPHGSYIKEKDVENMKYLKAVIKEVFRVHPPLPLIL--PRLLSEDV 376

  Fly   411 VISGYRVPAGTIVSMIPINSLYSEE----YFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFV 471
            .:.||.:.|||.|.   ||:...:.    :.|...||.|||.|.:..|..||    ||.      
plant   377 KVKGYNIAAGTEVI---INAWAIQRDPAIWGPDAEEFKPERHLDSTLDYHGK----DLN------ 428

  Fly   472 FLPFGFGPRMCVGKRIVEMELELGTARLIRNFN 504
            |:|||.|.|:|.|..:....:|:..|.|:..|:
plant   429 FIPFGSGRRICPGINLALGLVEVTVANLVGRFD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 108/458 (24%)
CYP71A12NP_180633.3 CYP71-like 63..489 CDD:410695 107/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.