DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and cyp26c1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001025122.2 Gene:cyp26c1 / 554036 ZFINID:ZDB-GENE-050714-2 Length:554 Species:Danio rerio


Alignment Length:415 Identity:88/415 - (21%)
Similarity:154/415 - (37%) Gaps:141/415 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 INRWTLESVSV------------VALDKQLGLLRESGKNSEATKLFKYL-DEFFLHSADLEMKPS 259
            |.:|..|:.||            :|:...|||..|..:.:..:|.|:.| :..|....|      
Zfish   169 IAKWCTETGSVEVYTAAKSLTFRIAVRVLLGLHLEEQQITYLSKTFEQLMNNLFSLPID------ 227

  Fly   260 LWRYFKTPL--LKKMLRTMDSVQEVTLKYVDEAIERLE------------KEAKEGVVRPEHEQS 310
                  ||:  |:|.:|..:.:.....|.::|.:::.:            ..|:|.    ::|.:
Zfish   228 ------TPVSGLRKGIRAREILHSAMEKIIEEKLKKQQASDYCDAFDYMLSSAREN----DYELT 282

  Fly   311 VLEKLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEV------------ 363
            :.|  ||       ..|::::.|...||:|..|:|::.|.::|:...|.|.|:            
Zfish   283 MQE--LK-------ETAVELIFAAHSTTASASTSLIMQLLRHPDVSERARAELESEGLITDGHGH 338

  Fly   364 --MKVLPNKDSEFTEASMK----------------------------NVPYLR-----------A 387
              .:...|..||..||:.|                            :||||.           .
Zfish   339 CRSRCNGNAISEEGEAAEKSTSDRRSAINKATYFEAGDKEEGRRSRTHVPYLSLEKLSQLSYLDC 403

  Fly   388 CIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLY-SEEYFPKPTEFLPERWLRN 451
            .:||..|..|.|.|..|.:.:...::||::|.|..| |..|...: :.|.:..|..|.|:|:   
Zfish   404 VVKEVLRFLPPVSGGYRTVLQTFELNGYQIPKGWSV-MYSIRDTHETAEAYQNPELFDPDRF--- 464

  Fly   452 ASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELE------LGTA----------RL- 499
                   |...:......|.::|||.|.|.|:|:.:..:.|:      |.||          |: 
Zfish   465 -------CVGREESKSERFSYVPFGGGVRRCIGRELALIVLKTLAVELLATADCTLATQTYPRMQ 522

  Fly   500 -------IRNFNVEFNHSTKNAFRS 517
                   :...:|.||:.|:...|:
Zfish   523 TVPIVHPVNGLHVFFNYRTQGIERN 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 88/415 (21%)
cyp26c1NP_001025122.2 p450 23..533 CDD:299894 83/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.