DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp26c1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001098671.1 Gene:Cyp26c1 / 546726 MGIID:2679699 Length:518 Species:Mus musculus


Alignment Length:551 Identity:114/551 - (20%)
Similarity:201/551 - (36%) Gaps:166/551 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVFSASQQRWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFAKSAL----PGGKYKNLEMMEM 77
            ::...:||.|     |.......:|....|   :||.::...|....|    .|.::.:      
Mouse    24 LLLGLAQQLW-----TLRWTLSRDWASTLP---LPKGSMGWPFFGETLHWLVQGSRFHS------ 74

  Fly    78 IDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNE-----GVWP----FRPGSDIL----- 128
              :.|:.||. :|...::||. ::.....::...:...|     ..||    ...||..|     
Mouse    75 --SRRERYGT-VFKTHLLGRP-VIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVG 135

  Fly   129 ---RYHRTVYRK--------DFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVN 182
               |..|.|..:        .|...:||.:..:.:||   .:...||.:......|.|:..::: 
Mouse   136 EPHRQRRKVLARVFSRSSLEQFVPRLQGALRREVRSW---CAAQRPVAVYQAAKALTFRMAARI- 196

  Fly   183 QEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEF 247
                                                     .|||..:..:.:|....|:.|.| 
Mouse   197 -----------------------------------------LLGLQLDEARCTELAHTFEQLVE- 219

  Fly   248 FLHSADLEMKPSLWRYFKTPL------LKKMLRTMDSVQEVTLKYVDEAI-ERLEKE--AKEG-- 301
                          ..|..||      |:|.:|..|.:.|    ::|||: |:|:::  |:.|  
Mouse   220 --------------NLFSLPLDVPFSGLRKGIRARDQLYE----HLDEAVAEKLQEKQTAEPGDA 266

  Fly   302 ---VVRPE----HEQSVLEKLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARL 359
               ::...    ||.||.|  ||       .:|:::|.|...||:|..|:|:|.|.::|....::
Mouse   267 LLLIINSARELGHEPSVQE--LK-------ELAVELLFAAFFTTASASTSLILLLLQHPAAITKI 322

  Fly   360 REEV--------MKVLPNK---------DSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLT 407
            ::|:        ....|..         :.:.:.|.:..:.|:...:||..|:.|.|.|..|...
Mouse   323 QQELSAQGLGRACTCTPRASGSPPDCGCEPDLSLAMLGRLRYVDCVVKEVLRLLPPVSGGYRTAL 387

  Fly   408 RDSVISGYRVPAGTIVSMIPINSLY--SEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPF 470
            |...:.||::|.|..| |..|...:  :..|...|..|.|||:...:.|:.|        :...|
Mouse   388 RTFELDGYQIPKGWSV-MYSIRDTHETAAVYRSPPEGFDPERFGVESGDARG--------SGGRF 443

  Fly   471 VFLPFGFGPRMCVGKRIVEMELELGTARLIR 501
            .::|||.|.|.|:|:.:.:..|:|....|:|
Mouse   444 HYIPFGGGARSCLGQELAQAVLQLLAVELVR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 103/483 (21%)
Cyp26c1NP_001098671.1 p450 40..500 CDD:386267 110/530 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.