DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and cyp27b1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001006907.1 Gene:cyp27b1 / 448754 XenbaseID:XB-GENE-942527 Length:506 Species:Xenopus tropicalis


Alignment Length:519 Identity:135/519 - (26%)
Similarity:238/519 - (45%) Gaps:66/519 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LNILQSQKPIVFSASQQRWQTNVPTAEIRNDPEWLQA-KPFEEIPKANILS----LFAKSALPGG 67
            |.:..|:...:|...|:.|...|    ::|..:.::. |...::|..:.:|    ||.:..|...
 Frog     5 LKLGSSRSSQLFRGLQELWAETV----LKNSEKVIKGHKSLADMPGPSTVSFISDLFCRRGLARL 65

  Fly    68 KYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMT-H--NPKDFEVVFRNEGVWPFRPGSDILR 129
            ....||            |...|.|......|.::| |  .|...|.|.|.||..|.|  ||:..
 Frog    66 HELQLE------------GKAKFGPVWKASFGPILTVHVAEPSLIEQVLRQEGKHPIR--SDLSS 116

  Fly   130 YHRTVYRKDFFD---GVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKE 191
            :      ||:..   ...|::.::|:.|..||||:...:::||.|..|...::.|..:.::.|..
 Frog   117 W------KDYRQCRGHSYGLLTAEGEEWQQFRSILGKHMLKPKEVEAYSDVLNDVVGDLIKKINY 175

  Fly   192 IRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHS-ADLE 255
            .|..:...|..:..:....:.||.:|.|..:.::|.| |.....|..|..:.::..|:.: ..:.
 Frog   176 QRSQNQNNVVKDIAKEFYMFGLEGISSVLFESRIGCL-EPTVPKETEKFIQSINTMFVMTLLTMA 239

  Fly   256 MKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLL---- 316
            |...|.:.|:.| .:|...:.|.:......::|:.::.:.::..:|       :.|..|.|    
 Frog   240 MPKFLHKIFRKP-WQKFCESWDYMFAFAKGHIDKRMKDVAQKLAQG-------EKVEGKYLTYYL 296

  Fly   317 ---KVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEAS 378
               |:..|.......::|:|||||.|||.:..|..||::|:.|:.:..||.::|..|... :.:.
 Frog   297 AQEKIPMKSIYGNVTELLLAGVDTISSTLSWSLYELAQHPDIQSAVYSEVEEILQGKQIP-SPSD 360

  Fly   379 MKNVPYLRACIKESQRVYPLVIGNARGLT-RDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTE 442
            :..:|.|:|.:||..|:||::.||||.:. ||..:..|.:|..|::::....:...|..|..|.|
 Frog   361 VARMPLLKAVVKEVLRLYPVIPGNARVVADRDIQVGDYIIPKKTLITLCHYATSRDENVFSNPNE 425

  Fly   443 FLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVE 506
            |.|:|||:...            |.:|:..||||||.|.|:|:||.|:|:.|..||::.:|.|:
 Frog   426 FQPDRWLKKED------------THHPYASLPFGFGKRSCIGRRIAELEVYLALARILSHFEVK 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 120/441 (27%)
cyp27b1NP_001006907.1 p450 45..503 CDD:365848 127/475 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I3126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3591
OMA 1 1.010 - - QHG48087
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9361
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.