DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp6d5

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650327.1 Gene:Cyp6d5 / 41706 FlyBaseID:FBgn0038194 Length:508 Species:Drosophila melanogaster


Alignment Length:450 Identity:108/450 - (24%)
Similarity:187/450 - (41%) Gaps:95/450 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 DILRYH-RTVYRKDFFDGVQ-GIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVEL 188
            |...:| |.||..:..|.:. .:...:|.||...|:.:.|.....| ::..|:....|..:.|:.
  Fly    93 DFASFHDRGVYVDEKNDPMSASLFQMEGASWRALRNKLTPSFTSGK-LKAMFETSDSVGDKLVDS 156

  Fly   189 IKEIRDASTQEVPGN---FLETINRWTLESVSVVALDKQLGLLRES--GKNSEATKLFKYLD--- 245
            |:       :::|.|   .||........::.::| ....||..:|  ..|:|...:.|.::   
  Fly   157 IR-------KQLPANGAKELELKKLMATYAIDIIA-TTIFGLDVDSFADPNNEFQIISKKVNRNN 213

  Fly   246 -EFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQ 309
             |..:......:.|.|.::|                 |.:.:..||.||:.:.:...|...|...
  Fly   214 IEDIIRGTSSFLYPGLEKFF-----------------VKIGWKQEATERMRELSNRTVDLREQNN 261

  Fly   310 SVLEKLLKV---------------------DKKVATVMAMDML--------MAGVDTTSSTFTAL 345
            .|.:.||::                     .|.....|:.|::        :||.:||:||.:..
  Fly   262 IVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMSKDLIAGQLFLFYVAGYETTASTTSFT 326

  Fly   346 LLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDS 410
            |..|.:|||...:.:|:|...:.....:.|..::.::.||.|||.|:.|.||.:....|..|:| 
  Fly   327 LYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACILETARKYPALPLLNRICTKD- 390

  Fly   411 VISGYRVP-------AGT--IVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKT 466
                |.||       .||  |:|:|.::.  .|||||.|..:.|||:|.|..|            
  Fly   391 ----YPVPDSKLVIQKGTPIIISLIGMHR--DEEYFPDPLAYKPERYLENGKD------------ 437

  Fly   467 KNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALINLPNIP 526
            .....:||||.|||||:|.|:.::.:::..|:::.||::|. ...|......:..:|.:|
  Fly   438 YTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEI-RKEKCEIEFGVYGIPLMP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 107/449 (24%)
Cyp6d5NP_650327.1 p450 66..478 CDD:278495 104/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.