DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp313a2

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster


Alignment Length:456 Identity:104/456 - (22%)
Similarity:183/456 - (40%) Gaps:99/456 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 MGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRS 159
            :|...:|:|.:||..|.|..:    ||    .|.|..:|........| .|::..||..|...|.
  Fly    73 IGTTPIVITRDPKIAEKVLTS----PF----CINRSSQTTNALALSMG-YGLLTLQGSKWMARRK 128

  Fly   160 IVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQ 224
            .:||....  :|.|.|  :...|.| .:|:..:.|:...:...:.|..:.||:.    .:|....
  Fly   129 HMNPAFKH--SVLLSF--LPIFNAE-TDLLVSVFDSFVGQGEKDVLSDLIRWSF----AIATQTT 184

  Fly   225 LGLLRESGKNSEATKLFKYLDEFFLHSADLEMKPSLWR---------YFKTPLLKKM-----LRT 275
            ||        ::.||     |:.|.:.|.|:...|:.|         :.:..::.|:     ||.
  Fly   185 LG--------TDVTK-----DDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLFGLEWLRR 236

  Fly   276 MD--SVQEVTLKYVDEAIER-----LEKEAKEGVVRP-----EHEQSVLEKLLKVDKKVATVMAM 328
            .|  ::.::....:|:.:..     .|.|.|..:.|.     ..|.|::|         ......
  Fly   237 RDASAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLME---------LGAECS 292

  Fly   329 DMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLP-NKDSEFTEASMKNVPYLRACIKES 392
            .|::|..:|::.|....|:.||..||.|..:..|:.:..| .|..|.|...::.:.||...:.|:
  Fly   293 SMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNET 357

  Fly   393 QRVYPLVIGNARGLTRDSVIS-GYRVPAGTIVSMIPINSLYSEEYFP------KPTEFLPERWLR 450
            .|:.|.|..::|....|..:| |..:|.|..:|:...|:..:.:|:.      .|..||||:   
  Fly   358 LRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEK--- 419

  Fly   451 NASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNF---------NVE 506
                         :..::|:.|:||..|.|.|:|.|...|..:|...:::||:         |:|
  Fly   420 -------------IHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLE 471

  Fly   507 F 507
            |
  Fly   472 F 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 104/456 (23%)
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 101/445 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.