DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp313a5

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster


Alignment Length:396 Identity:84/396 - (21%)
Similarity:157/396 - (39%) Gaps:91/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQE---FVELIKEIRDASTQEVPGNFLE 206
            |::..:...|.:.|.::.|..  ..|..|.|  :..:|.|   .|.|:.|..|....    |.|.
  Fly   113 GLLTLKNNHWNERRKLLLPSF--KNNAVLSF--VPVLNNEANFLVTLLAEFVDGGDI----NLLP 169

  Fly   207 TINRWTLESVSVVAL--------DKQLGLLRESGK----------------NSEATKLFKYLDEF 247
            .:|:|:.:..:.:.:        :.|.|.|.||.|                |....|||.|    
  Fly   170 ELNKWSFKIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSY---- 230

  Fly   248 FLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVL 312
              ....||.......:.|..:.||:..|.:|                            .|.:::
  Fly   231 --EKRRLEAATQSNAFIKDIIDKKLSSTDNS----------------------------SEPALI 265

  Fly   313 EKLLKV----DKKVATVMA--MDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPN-K 370
            :::|.:    :.....||.  .:::.|..||.|.|...:|:.:|..|:.|..:.||:.:|.|: .
  Fly   266 DRILNLVRIGELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGG 330

  Fly   371 DSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVIS-GYRVPAGTIVSMIPINSLYSE 434
            :.|.:.|.::.:..|...:.|:.|:.|.|....|..:....:| |:.:|.| :..||.|...:..
  Fly   331 EFEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEG-VTLMIDIFHTHRN 394

  Fly   435 E--YFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTA 497
            :  :.|:...|.|:.:|          |.|. :.:.|:.:|||..|.:.|:|.::..:..:|..|
  Fly   395 KDIWGPQANAFNPDNFL----------PENK-RARPPYSYLPFSKGKKTCLGWKLSLISAKLALA 448

  Fly   498 RLIRNF 503
            :::||:
  Fly   449 KILRNY 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 84/396 (21%)
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 84/396 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.