DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and Cyp313b1

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster


Alignment Length:545 Identity:109/545 - (20%)
Similarity:199/545 - (36%) Gaps:175/545 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LEMM------EMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFR-----NEGVWPFRPGS 125
            |:||      :.:|.|.:.: ...|: ..||....:..::|...|.:..     |:|        
  Fly    45 LQMMNPETFLQYMDGLSRQF-KAPFI-SWMGTSCFLYINDPHSVEQILNSTHCTNKG-------- 99

  Fly   126 DILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIK 190
            |..|:..:...       .|:..|....|...|.::||                           
  Fly   100 DFYRFMSSAIG-------DGLFTSSSPRWHKHRRLINP--------------------------- 130

  Fly   191 EIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLE 255
                |..:::..|||...|     :.:.|.|.|   |..|..::.:..::::.|.:..|.:|   
  Fly   131 ----AFGRQILSNFLPIFN-----AEAEVLLQK---LELEGVQHGKRLEIYQILKKIVLEAA--- 180

  Fly   256 MKPSLWRYFKTPLLKKM----------LRTMDSVQEVTLK------------YVDEAIERLE--- 295
                    .:|.:.|||          .:..:.:.||.:|            |....:.||:   
  Fly   181 --------CQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKV 237

  Fly   296 --------KEAKEGVV-------RPEHEQSVLE-----KLLKVDKKVATV------------MAM 328
                    ::..|.:|       .|:.::|.:|     |.:.:::....|            .|.
  Fly   238 VGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEAN 302

  Fly   329 DMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQ 393
            ..:.|..:|||:.....:||||.:|..|.:|.:|::..|| ...:.....::.:.|....|.|:.
  Fly   303 VTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELP-PSGDINLEQLQRLEYTEMVINEAM 366

  Fly   394 RVY---PLVIGNA-------RGLTRDSVISG-YRVPAGTIVSMIPINSLYSEE--YFPKPTEFLP 445
            |::   |:|:.:|       ||       .| :.:|.||.:. |.|.::..:|  :.|....:.|
  Fly   367 RLFAPVPMVLRSADQDIQLKRG-------DGEFLIPRGTQIG-IDIYNMQRDERVWGPLSRTYNP 423

  Fly   446 ERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHS 510
            :...           ..|...::.|.|:||..|.|||:|.|..:|.::|..||:.|::.:    |
  Fly   424 DAHF-----------GLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRI----S 473

  Fly   511 TKNAFRSALINLPNIPLKFKFTDVP 535
            |:......|:. .||.||.|  |.|
  Fly   474 TEARLEELLVK-GNISLKLK--DYP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 102/524 (19%)
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 99/519 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.