DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12a5 and shd

DIOPT Version :9

Sequence 1:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster


Alignment Length:473 Identity:134/473 - (28%)
Similarity:232/473 - (49%) Gaps:25/473 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHR 132
            :||..::.|:...|.:.||:|: |..|.....:|..:|..|.|.|.:....:||||.::|:..:|
  Fly    83 RYKMTKLHEVYADLNRQYGDIV-LEVMPSNVPIVHLYNRDDLEKVLKYPSKYPFRPPTEIIVMYR 146

  Fly   133 TVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDAST 197
            . .|.|.:..| ||:..||..|...||.:...:..|:.::.:...::.|..:|:||::..||..|
  Fly   147 Q-SRPDRYASV-GIVNEQGPMWQRLRSSLTSSITSPRVLQNFLPALNAVCDDFIELLRARRDPDT 209

  Fly   198 QEVPGNFLETINRWTLESVSVVALDKQLGLLR-ESGKNSEATKLFKYLDEFFLHSADLEMKPSLW 261
            ..|| ||.|..|...||:|..:.|.:::|.|. ::.:..:.::|...:.:.|:...|......||
  Fly   210 LVVP-NFEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLGLW 273

  Fly   262 RYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKV------DK 320
            :||.|...:...|..|.:.:|..:.:|..:|.|:|.|..........:|:...:|::      ||
  Fly   274 KYFPTKTYRDFARAEDLIYDVISEIIDHELEELKKSAACEDDEAAGLRSIFLNILELKDLDIRDK 338

  Fly   321 KVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYL 385
            |.|.:   |.:.||::|.::|...:|..:..:|....|:..|..:.   :|:...:.::.|..|.
  Fly   339 KSAII---DFIAAGIETLANTLLFVLSSVTGDPGAMPRILSEFCEY---RDTNILQDALTNATYT 397

  Fly   386 RACIKESQRVYPLVIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLR 450
            :|||:||.|:.|.....||.|..|..:|||.:.|||:|....:.:.:.:..|....:|.||||:.
  Fly   398 KACIQESYRLRPTAFCLARILEEDMELSGYSLNAGTVVLCQNMIACHKDSNFQGAKQFTPERWID 462

  Fly   451 NASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAF 515
            .|:::.      .:...|..:.:|||.|.|.|.|||.||||:.|..|:::..|:|.|....:..|
  Fly   463 PATENF------TVNVDNASIVVPFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLETEF 521

  Fly   516 RSALINLPNIPLKFKFTD 533
            ...|  .|..||..:.:|
  Fly   522 EFLL--APKTPLSLRLSD 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 130/456 (29%)
shdNP_001261843.1 p450 63..528 CDD:299894 130/462 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.